Lus10032232 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62760 127 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 97 / 1e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 96 / 3e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 94 / 1e-23 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 89 / 7e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 89 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G51520 87 / 3e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 88 / 4e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 83 / 1e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G12390 80 / 2e-18 PME1 pectin methylesterase inhibitor 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024595 311 / 1e-108 AT1G62760 141 / 6e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10028910 184 / 1e-58 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10004327 177 / 7e-56 AT1G62760 164 / 8e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 108 / 2e-29 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 108 / 2e-29 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 105 / 4e-28 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 100 / 2e-26 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031717 100 / 4e-26 AT5G62360 179 / 3e-57 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 100 / 5e-26 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G119300 123 / 6e-35 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113600 122 / 1e-34 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 112 / 5e-31 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 112 / 1e-30 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 99 / 7e-26 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 96 / 2e-24 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 94 / 6e-24 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127400 92 / 3e-23 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 92 / 5e-23 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.015G128500 89 / 1e-21 AT4G25250 144 / 2e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10032232 pacid=23168516 polypeptide=Lus10032232 locus=Lus10032232.g ID=Lus10032232.BGIv1.0 annot-version=v1.0
ATGAACACAGCTCCAGCAGCAGCAATCTTCACACTAATCATCATCTCTACCCAACTCCTCCTTTCAACCACCGTCGCCGCCGAACAAACCACCACCGCGG
ACTTCATCAAAACCTCCTGCAACTCAACCCTCTACCGCAAACTCTGCTTCCGATCACTCTCCCCGTACGCCTCCGAAATCGGATCCGACCCGAAACTCCT
CGCACTCAAGTCCCTCAACATAACCCTCGAAGTCTCCCAATCCGCATCCAAGCTCATGAAGCGTATCGCCCGGATCCCCGGCGTCACCGGGGCAGCGGCG
GACTGCGTCGAGGAGGTCGAGAACGCGGTGGACGCTCTGGCCAAGTCGATGGGAGAACTCCGTGGGGCTCCGAAAGGGGGAGAGCCCGGGTTCTGTCGGG
TCATCGACGACGTGGAGACTTTTGTCAGTGCAGCGGAGACGTTTGACGAGACGTGTATTGATGGGTTTGAGGAGGCGGCGGGGAGGATAGTTGGTGGGTC
GTCGTCGGCGGCGAAGGTTAACCGGAATGCGAAGAAGATTGTGGAGAAAAGGGTGAAGAAGGTCGAGAAGTATACGAGTAATTGTTTGGCCTTGGTTGAT
CTCTACGCTTCTGTGGAATTTCGCCATGTTAAGTGTTGA
AA sequence
>Lus10032232 pacid=23168516 polypeptide=Lus10032232 locus=Lus10032232.g ID=Lus10032232.BGIv1.0 annot-version=v1.0
MNTAPAAAIFTLIIISTQLLLSTTVAAEQTTTADFIKTSCNSTLYRKLCFRSLSPYASEIGSDPKLLALKSLNITLEVSQSASKLMKRIARIPGVTGAAA
DCVEEVENAVDALAKSMGELRGAPKGGEPGFCRVIDDVETFVSAAETFDETCIDGFEEAAGRIVGGSSSAAKVNRNAKKIVEKRVKKVEKYTSNCLALVD
LYASVEFRHVKC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62760 Plant invertase/pectin methyle... Lus10032232 0 1
AT5G45960 GDSL-like Lipase/Acylhydrolase... Lus10005280 3.6 0.6988
AT1G64780 ATAMT1;2 ammonium transporter 1;2 (.1) Lus10040677 5.5 0.6882
AT1G73390 Endosomal targeting BRO1-like ... Lus10031881 14.4 0.6898
AT5G40450 unknown protein Lus10001136 16.0 0.6798
AT5G40230 nodulin MtN21 /EamA-like trans... Lus10034877 24.0 0.6602
AT1G62700 NAC ANAC026, VND5 VASCULAR RELATED NAC-DOMAIN PR... Lus10004338 25.7 0.6517
AT3G28050 nodulin MtN21 /EamA-like trans... Lus10039430 28.6 0.6345
AT1G74780 Nodulin-like / Major Facilitat... Lus10033115 30.9 0.6760
AT2G44970 alpha/beta-Hydrolases superfam... Lus10028185 34.8 0.5963
AT2G30910 ARPC1B, ARPC1, ... actin-related protein C1A (.1.... Lus10031375 36.0 0.6653

Lus10032232 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.