Lus10032233 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70720 78 / 6e-18 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 75 / 5e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 75 / 8e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 74 / 1e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 72 / 1e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 71 / 3e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 68 / 3e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 67 / 1e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 64 / 6e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G23205 59 / 4e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024596 279 / 3e-97 AT5G62360 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 77 / 7e-18 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 77 / 1e-17 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 77 / 2e-17 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 77 / 2e-17 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038645 77 / 2e-17 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 76 / 4e-17 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10037919 74 / 1e-16 AT1G14890 137 / 3e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027199 67 / 1e-13 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G109300 78 / 7e-18 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127400 76 / 2e-17 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128900 76 / 3e-17 AT4G25250 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 75 / 7e-17 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.015G128100 73 / 4e-16 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 71 / 2e-15 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113600 71 / 3e-15 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.008G132600 71 / 3e-15 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 70 / 3e-15 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128500 70 / 5e-15 AT4G25250 144 / 2e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10032233 pacid=23168508 polypeptide=Lus10032233 locus=Lus10032233.g ID=Lus10032233.BGIv1.0 annot-version=v1.0
ATGAACACTTCACCAACCTTTCTCCTTCTACTCCTAATCACAGCCGCCATCTCCGCAGCCGACACGGATTACATCCAAACCTCACGCCAAGCCTCCACTC
GCTACCCGGACCTGTGCATCTCAACCTTGTCCCCACAAGCCTCCAACATAACCACCCCCAAGCTCCTCTCCTCGGCCGCCCTCTATGCAGCCCTGGCCGC
GGCCAAGTCCACTTCGAAATCGATCGAGACGAGGCCGTCCTCGTGGAGTCCCTGGCTGAGGGACTGCAGGGAGGAGTTGGGTGACTCGGTGGACCGGCTC
CGCGACTCGGCCAAGGAGATGAAAGGTGAGGTAGTGCTGAGTAGGTTCCAGGTCAGCAACGTACAGACGTGGGCCAGCGCTGTAATGACGTGTATGGACA
CGTGTACGGATGGGTTGGTGGAAGGGGAAGTGAAGAGATGGGTTGTGGAGAAGAGTGGGATTGTCAAGGCTGGGTTTCTGATTAGTAATGCCTTGGAGTT
TGTTAATAAGTATGGTGATGGTCTTGTTAATCAGTGA
AA sequence
>Lus10032233 pacid=23168508 polypeptide=Lus10032233 locus=Lus10032233.g ID=Lus10032233.BGIv1.0 annot-version=v1.0
MNTSPTFLLLLLITAAISAADTDYIQTSRQASTRYPDLCISTLSPQASNITTPKLLSSAALYAALAAAKSTSKSIETRPSSWSPWLRDCREELGDSVDRL
RDSAKEMKGEVVLSRFQVSNVQTWASAVMTCMDTCTDGLVEGEVKRWVVEKSGIVKAGFLISNALEFVNKYGDGLVNQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62360 Plant invertase/pectin methyle... Lus10032233 0 1
AT2G18360 alpha/beta-Hydrolases superfam... Lus10028302 2.0 0.8431
AT3G13960 GRF ATGRF5 growth-regulating factor 5 (.1... Lus10037668 2.4 0.8731
AT3G26120 TEL1 terminal EAR1-like 1 (.1) Lus10006234 6.9 0.8327
AT4G37810 unknown protein Lus10011570 10.6 0.8084
AT3G13960 GRF ATGRF5 growth-regulating factor 5 (.1... Lus10004455 11.4 0.8427
AT1G50660 unknown protein Lus10043111 13.0 0.8210
Lus10038805 18.3 0.7514
AT1G25580 NAC ANAC008, SOG1 SUPPRESSOR OF GAMMA RADIATION ... Lus10021708 18.4 0.7949
AT1G04150 C2 calcium/lipid-binding plant... Lus10000164 20.6 0.8446
AT5G35770 SAP STERILE APETALA, Transducin/WD... Lus10006384 23.2 0.8446

Lus10032233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.