Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03380 62 / 1e-12 Heavy metal transport/detoxification superfamily protein (.1.2) AT2G36950 62 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1) AT5G60800 56 / 2e-10 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G50740 54 / 4e-10 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) AT5G63530 50 / 1e-08 ATFP3 ARABIDOPSIS THALIANA FARNESYLATED PROTEIN 3, farnesylated protein 3 (.1.2) AT2G28090 49 / 6e-08 Heavy metal transport/detoxification superfamily protein (.1) AT3G56891 45 / 4e-07 Heavy metal transport/detoxification superfamily protein (.1) AT5G24580 45 / 1e-06 Heavy metal transport/detoxification superfamily protein (.1.2.3) AT3G02960 45 / 1e-06 Heavy metal transport/detoxification superfamily protein (.1) AT5G27690 44 / 2e-06 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022617 [exp] 107 / 5e-29 AT2G36950 178 / 2e-51 Heavy metal transport/detoxification superfamily protein (.1) Lus10021516 [exp] 106 / 8e-29 AT5G03380 202 / 2e-61 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10023924 [exp] 82 / 5e-20 AT5G03380 180 / 6e-54 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10014421 [exp] 82 / 1e-19 AT5G03380 193 / 5e-57 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10021432 [exp] 61 / 5e-12 AT5G60800 158 / 1e-46 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016133 [exp] 61 / 5e-12 AT5G60800 175 / 3e-52 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10012867 [exp] 54 / 1e-09 AT2G40770 1843 / 0.0 zinc ion binding;DNA binding;helicases;ATP binding;nucleic acid binding (.1) Lus10030514 [exp] 53 / 2e-09 AT5G50740 221 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Lus10039074 [exp] 53 / 2e-09 AT5G50740 182 / 8e-57 Heavy metal transport/detoxification superfamily protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G093100 [exp] 79 / 1e-18 AT2G36950 123 / 5e-32 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G124800 [exp] 76 / 1e-17 AT2G36950 135 / 2e-36 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G007600 [exp] 57 / 6e-11 AT5G60800 157 / 1e-45 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G214700 [exp] 56 / 2e-10 AT5G60800 142 / 7e-40 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.016G006600 [exp] 52 / 2e-09 AT5G50740 153 / 5e-45 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Potri.012G101400 [exp] 52 / 4e-09 AT5G63530 204 / 2e-63 ARABIDOPSIS THALIANA FARNESYLATED PROTEIN 3, farnesylated protein 3 (.1.2) Potri.015G099500 [exp] 52 / 4e-09 AT5G50740 214 / 7e-68 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Potri.006G006100 [exp] 51 / 7e-09 AT5G50740 143 / 2e-41 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Potri.004G175400 [exp] 45 / 7e-07 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.012G007300 [exp] 45 / 8e-07 AT5G24580 251 / 5e-82 Heavy metal transport/detoxification superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10032245 pacid=23168671 polypeptide=Lus10032245 locus=Lus10032245.g ID=Lus10032245.BGIv1.0 annot-version=v1.0 ATGGATATGCATTGCGAAGGATGCGCGAAGAAGATCTGCCGCGCACTCAAGCACATGGACGGAGTGGAATATGTGAAGACGGACTGTGAAACCATTAAGC TTACAGTGATCGGGAAGGTGGATCCCGACCGGGTGAAATCGAGGATCGAGGAGAAGACTAAGAAGAAGGTGGAGATTGTTTCTCCTCAGCCGAAGAAGGA CGGCGGCGGCGGTGGAACTGCTCCTGCCGAGATAAGAAGGGCGGAGGAGGAGCTCCCTCCCTCTAACCTTCTTCGACACTCTGTGGATTAA
AA sequence Show only first row Show all	>Lus10032245 pacid=23168671 polypeptide=Lus10032245 locus=Lus10032245.g ID=Lus10032245.BGIv1.0 annot-version=v1.0 MDMHCEGCAKKICRALKHMDGVEYVKTDCETIKLTVIGKVDPDRVKSRIEEKTKKKVEIVSPQPKKDGGGGGTAPAEIRRAEEELPPSNLLRHSVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36950			Heavy metal transport/detoxifi...		Lus10032245 [exp]	0	1
AT2G36840		ACR10	ACT domain repeats 10, ACT-lik...		Lus10023921 [exp]	15.5	0.8896
AT3G49200			O-acyltransferase (WSD1-like) ...		Lus10019840 [exp]	18.7	0.8684
AT4G00335		RHB1A	RING-H2 finger B1A (.1.2.3)		Lus10017788 [exp]	20.8	0.8619
AT3G53490			unknown protein		Lus10015041 [exp]	21.6	0.8830
AT1G32130		HNI9, ATIWS1	HIGH NITROGEN INSENSITIVE 9, A...		Lus10035391 [exp]	26.2	0.8731
AT1G32130		HNI9, ATIWS1	HIGH NITROGEN INSENSITIVE 9, A...		Lus10030992 [exp]	30.0	0.8776
					Lus10038662 [exp]	39.0	0.8133
AT1G67623			F-box family protein (.1)		Lus10037978 [exp]	59.9	0.8569
AT4G30230			unknown protein		Lus10036511 [exp]	72.0	0.8528
AT1G27060			Regulator of chromosome conden...		Lus10037219 [exp]	84.8	0.8542

Compare expression of checked genes

Lus10032245 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.