Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12510 125 / 6e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 125 / 6e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 123 / 5e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 118 / 5e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 117 / 6e-35 ELP extensin-like protein (.1) AT4G12480 114 / 3e-33 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 114 / 6e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12550 110 / 3e-32 AIR1 Auxin-Induced in Root cultures 1 (.1) AT4G12490 112 / 5e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 108 / 6e-31 AZI1 azelaic acid induced 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032253 [exp] 183 / 1e-60 ND 139 / 2e-43 Lus10024616 [exp] 174 / 2e-57 AT4G12520 139 / 2e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024615 [exp] 174 / 6e-57 ND 139 / 6e-43 Lus10004346 [exp] 126 / 4e-38 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004348 [exp] 125 / 1e-37 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 124 / 3e-37 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 124 / 3e-37 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024627 [exp] 122 / 2e-36 AT4G12520 136 / 3e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024625 [exp] 121 / 3e-36 AT4G12520 158 / 5e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 129 / 2e-39 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 127 / 1e-38 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 124 / 1e-37 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 120 / 3e-36 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 115 / 4e-34 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 111 / 2e-32 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 103 / 3e-29 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.013G128800 [exp] 97 / 1e-26 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 99 / 4e-26 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 88 / 8e-23 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10032254 pacid=23168633 polypeptide=Lus10032254 locus=Lus10032254.g ID=Lus10032254.BGIv1.0 annot-version=v1.0 ATGGCTGCAACCAAGACCATTGCCATCTTCCTAGCCATCAACTTGCTCATCTTCACCACTTCCCCGGTCTCGGCCTGCGGAGGTGGCTGCCCGACCCCGA AACCCTGGCCTAAACCTACCCCTAACCCTAACCCTACCCCATTAGGAAAATGCCCGAGGGACACGCTCAAGTTGGGCGTATGTGCCAACGTGCTCAACTT GGTCCACGCCAAGGTCGGATCTCCACCGGTCCAACCGTGTTGCAGTCTTCTGGAAGGGTTGGTCGATTTGGAAGTGGCGGTTTGTCTTTGTACTGCCATC AAGGCCAACATTCTCGGAATCAACCTCAACATTCCCGTCGCACTTAGCTTGCTTCTTAATGTGTGTGGCACCTCTGTCCCACCTAGCTTCCAATGTTGA
AA sequence Show only first row Show all	>Lus10032254 pacid=23168633 polypeptide=Lus10032254 locus=Lus10032254.g ID=Lus10032254.BGIv1.0 annot-version=v1.0 MAATKTIAIFLAINLLIFTTSPVSACGGGCPTPKPWPKPTPNPNPTPLGKCPRDTLKLGVCANVLNLVHAKVGSPPVQPCCSLLEGLVDLEVAVCLCTAI KANILGINLNIPVALSLLLNVCGTSVPPSFQC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032254 [exp]	0	1
					Lus10032253 [exp]	1.0	0.9961
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10024616 [exp]	1.4	0.9874
AT5G62280			Protein of unknown function (D...		Lus10027191 [exp]	3.0	0.9819
AT2G45570		CYP76C2	"cytochrome P450, family 76, s...		Lus10027426 [exp]	5.0	0.9744
AT3G61920			unknown protein		Lus10023060 [exp]	5.5	0.9723
AT4G14750		IQD19	IQ-domain 19 (.1)		Lus10021904 [exp]	7.5	0.9721
AT4G14750		IQD19	IQ-domain 19 (.1)		Lus10041188 [exp]	7.9	0.9615
AT2G47270	bHLH	bHLH151, UPB1	UPBEAT1, sequence-specific DNA...		Lus10010001 [exp]	8.0	0.9721
AT3G63200		PLP9, PLAIIIB ,...	PATATIN-like protein 9 (.1)		Lus10022040 [exp]	8.7	0.9598
AT1G08460		HDA8, HDA08, AT...	histone deacetylase 8 (.1)		Lus10001850 [exp]	8.8	0.9591

Compare expression of checked genes

Lus10032254 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.