Lus10032256 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12510 101 / 9e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12520 101 / 9e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G62510 99 / 2e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12480 99 / 3e-25 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G45180 94 / 6e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12500 95 / 8e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12470 94 / 2e-23 AZI1 azelaic acid induced 1 (.1)
AT4G12490 94 / 2e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G12090 92 / 4e-23 ELP extensin-like protein (.1)
AT5G46890 90 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024619 154 / 6e-47 AT4G12490 120 / 4e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10028929 112 / 6e-31 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032257 113 / 8e-31 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024620 112 / 3e-30 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024626 109 / 1e-29 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004348 109 / 1e-29 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004346 109 / 1e-29 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024621 110 / 2e-29 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032261 107 / 7e-29 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G158400 107 / 4e-29 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G111400 106 / 1e-28 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121900 103 / 1e-27 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121800 91 / 9e-23 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G256100 88 / 1e-21 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.014G059800 84 / 3e-20 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.018G025900 83 / 8e-20 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G122100 79 / 9e-17 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G008500 76 / 1e-16 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
Potri.013G128800 75 / 1e-16 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Lus10032256 pacid=23168616 polypeptide=Lus10032256 locus=Lus10032256.g ID=Lus10032256.BGIv1.0 annot-version=v1.0
ATGGCTTCCAAAACAAAATCAACCTTGCTTCTCATCCTTGCACTCAACATTCTCTTCTTCTCCATGATTTTCGCGAGCCCAAACCCTAAACCAACACATA
CTCCAGTGCCAATACCAACTAACCCAAACCATACTCCTATACCTAGTCTGAGTCGTGCACCAACACCTAACCCAAACCCTACACCAACACCTAGTCCGGA
TCGTGAACCTACACCTAACCCAAACCCTAAACAAACACCTACCCCTAATCCAAGTCCAGCATCAACACCTACTTCTAGTCCATATCTTGCACCAACACGC
AACCCAAACCCTGATCCGACACCTACTAATCTGAACCTGAACCCAACACCTACTACACCTAGTCCAAATCATGCACCAACACCTACTCCTAGTCCAAATC
CTGCACCAACACCTGGCCCAAACTCCAAACCAACACCTACTCCTAGTCCGACTGCACCAACACGTAGCCCAAACCCTTCGCCAACACCTACTAATCCTAA
CCCGACACCAACCCCTAGCCCGAACCCTTCGCAAACACCTTCTAATCCTAACCCGCCACCAACTCCTAGCCCTTCGAGTGGGAAATGCCCCGTTAATGTA
CTCAAGTTCCGTGTTTGTGGCAATCTACTCAACATCGGGAATAGGAACGCACCGGTTCGACCTTGTTGTAGTTTGATCAATGGACTTGTTGATTTTGATG
CCGCTGTTTGCTTTTGCACTGCCATCAAAGACAACATTCTCGGCTTCAACGTCAATATTCCGGTTTCTTTCAGCTTGCTTCTCAATGCGTGCGGCAAGAG
TGCTCCCTCTGGCTTCCAGTGTTCTTAA
AA sequence
>Lus10032256 pacid=23168616 polypeptide=Lus10032256 locus=Lus10032256.g ID=Lus10032256.BGIv1.0 annot-version=v1.0
MASKTKSTLLLILALNILFFSMIFASPNPKPTHTPVPIPTNPNHTPIPSLSRAPTPNPNPTPTPSPDREPTPNPNPKQTPTPNPSPASTPTSSPYLAPTR
NPNPDPTPTNLNLNPTPTTPSPNHAPTPTPSPNPAPTPGPNSKPTPTPSPTAPTRSPNPSPTPTNPNPTPTPSPNPSQTPSNPNPPPTPSPSSGKCPVNV
LKFRVCGNLLNIGNRNAPVRPCCSLINGLVDFDAAVCFCTAIKDNILGFNVNIPVSFSLLLNACGKSAPSGFQCS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G12490 Bifunctional inhibitor/lipid-t... Lus10032256 0 1
Lus10011588 2.2 0.7926
Lus10003223 3.5 0.6899
AT5G20630 ATGER3, GLP3A, ... GERMIN-LIKE PROTEIN 3, ARABIDO... Lus10020851 7.3 0.6722
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10017306 12.6 0.6905
AT5G42905 Polynucleotidyl transferase, r... Lus10005922 21.8 0.6575
AT2G01690 ARM repeat superfamily protein... Lus10003679 21.8 0.6851
AT1G18310 glycosyl hydrolase family 81 p... Lus10038600 22.0 0.6759
AT4G24690 AtNBR1 Arabidopsis thaliana next to B... Lus10043320 30.0 0.5958
AT5G13660 unknown protein Lus10005963 33.2 0.6566
AT4G17810 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers sup... Lus10000481 35.2 0.6566

Lus10032256 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.