Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12480 92 / 3e-24 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 89 / 8e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 89 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 87 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 87 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 87 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 86 / 1e-21 AZI1 azelaic acid induced 1 (.1) AT2G45180 79 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 78 / 5e-19 ELP extensin-like protein (.1) AT4G12550 73 / 3e-17 AIR1 Auxin-Induced in Root cultures 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024620 [exp] 125 / 6e-37 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024621 [exp] 122 / 1e-35 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 102 / 4e-28 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 100 / 1e-27 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024622 [exp] 101 / 3e-27 ND 130 / 1e-38 Lus10024626 [exp] 99 / 5e-27 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 97 / 3e-26 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10028929 [exp] 94 / 3e-25 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 92 / 9e-25 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 90 / 1e-23 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 90 / 2e-23 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 88 / 7e-23 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 73 / 3e-17 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 72 / 1e-16 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008300 [exp] 71 / 1e-15 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 70 / 2e-15 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.001G121800 [exp] 68 / 5e-15 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 64 / 9e-13 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G015500 [exp] 63 / 3e-12 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10032257 pacid=23168649 polypeptide=Lus10032257 locus=Lus10032257.g ID=Lus10032257.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAAGCAAGCTCAAACTTGGCTCTCTTCCTTGCACTCAACCTTCTCTTCTTCTCCATGGTCTCTGCGCATTGTGGTGGTGGTTGTCCTACTC CGAATCCAAACCCTAAACCAACACCTACTCCTAACCCTACACCAACTCCCGCTATCCCAAACCCTACACCAACACCTAGTATCCCCAACCCAAACCCTAC ACCAACACCTAGCTCTTCAAGTGGGAAATGCCCCATTGATGCACTCAAGTTGGGCGTATGTGCTGATGTTCTTAGCAATTTGCTCAATATCAAGATCGGG AGCACACCGGTTCAACCTTGTTGTAGCTTGCTCAATGGACTTGCTGATCTTGATGCAGCTGTATGCCTTTGTACTGCCATCAAAGCCAACATTCTCGGCA TCAATCTCAACCTCCCAATCTCCCTCAGCTTGCTTCTCAACGCCTGCGACAAGAATGCTGCATCTGGCTTCCAGTGCTCTTAA
AA sequence Show only first row Show all	>Lus10032257 pacid=23168649 polypeptide=Lus10032257 locus=Lus10032257.g ID=Lus10032257.BGIv1.0 annot-version=v1.0 MASKASSNLALFLALNLLFFSMVSAHCGGGCPTPNPNPKPTPTPNPTPTPAIPNPTPTPSIPNPNPTPTPSSSSGKCPIDALKLGVCADVLSNLLNIKIG STPVQPCCSLLNGLADLDAAVCLCTAIKANILGINLNLPISLSLLLNACDKNAASGFQCS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12490			Bifunctional inhibitor/lipid-t...		Lus10032257 [exp]	0	1
AT2G36170			Ubiquitin supergroup;Ribosomal...		Lus10022695 [exp]	1.0	0.8685
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001037 [exp]	11.2	0.7610
					Lus10022893 [exp]	11.8	0.7492
AT3G21260		GLTP3	GLYCOLIPID TRANSFER PROTEIN 3,...		Lus10018917 [exp]	12.6	0.7320
AT5G52790			CBS domain-containing protein ...		Lus10027528 [exp]	19.5	0.7040
AT1G72490			unknown protein		Lus10013160 [exp]	25.2	0.7142
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10036043 [exp]	25.8	0.7647
AT3G55310			NAD(P)-binding Rossmann-fold s...		Lus10006695 [exp]	25.9	0.7523
AT4G35160			O-methyltransferase family pro...		Lus10018628 [exp]	31.4	0.7366
AT1G06990			GDSL-like Lipase/Acylhydrolase...		Lus10042245 [exp]	40.2	0.7167

Compare expression of checked genes

Lus10032257 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.