Lus10032258 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12510 73 / 2e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12520 73 / 2e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12470 67 / 1e-13 AZI1 azelaic acid induced 1 (.1)
AT4G12480 67 / 1e-13 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12500 67 / 2e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G62510 65 / 5e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12490 65 / 7e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G45180 64 / 1e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G12090 58 / 1e-10 ELP extensin-like protein (.1)
AT4G12530 56 / 5e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004348 89 / 4e-22 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032261 87 / 3e-21 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1)
Lus10024626 87 / 3e-21 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032259 84 / 2e-20 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024622 84 / 2e-19 ND 130 / 1e-38
Lus10024620 79 / 1e-17 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024621 79 / 1e-17 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032257 78 / 1e-17 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024623 72 / 2e-15 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G158400 83 / 7e-20 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121900 68 / 2e-14 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G111400 67 / 4e-14 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.013G128800 61 / 1e-11 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G008500 58 / 4e-10 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
Potri.006G008300 57 / 8e-10 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G122100 57 / 2e-09 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.018G025900 55 / 2e-09 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G256100 53 / 6e-09 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.016G015500 53 / 6e-08 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10032258 pacid=23168585 polypeptide=Lus10032258 locus=Lus10032258.g ID=Lus10032258.BGIv1.0 annot-version=v1.0
ATGGCTTCCAAAGCAAACTCAACGTTGGCTCTCTCCCTCGCGATCAACATTCTCTTCTTCTCCATGGTCTCTGCACATTGCGACTGCCCAAACCCTACTC
CTAACCCGAACCCGAAGCCCACACCAACACCCCGAACCCCAAACCCTACACCAACTCCGAGCTCTTCAAGTGGGAAATGCCCCATCGATACACTCAAGTT
GGGTGTTTGTGCTAATGTGCTTGGAAATTTGCTCAATATTATAATTGGAAGCACACCGGCCAAACCTTGTTGTAGCTTGATTAGTGGACTTGCTGATCTC
GATGCTTCTTCGCCGTTAACACATCTGCTGCCGCCATCATCCTCCCAATCATCCATCACCGTCTTCACCAAATCGCATCAACACCCTTCGTCGTCCTCCT
GTCTCCAAGCACCATCCACTGCTATCATCCGCTTAAATCATCTCACATCGTCACCATCATCATCTACTGTCGTCACGAACCGTCAATCACCACCCATTAT
CGCTGCCATCACCATGCATCCCCCGCCACGACAATTGAGACTCCTGCCGACACATCAACTCGTGAATGCTAGCGTGACTCAGCCCAGACAGGATCAACCG
TCCCAGCAGCGCGGATCAGGGGCTCGGCGGCCAGCACCTCCGACGATGCAACCGCCAATCAGTGTCACTCCACTGACGGATGCTCCCGCGACGGCTTCAC
CAGAGATCCTGATTCCCTCGGTGTTTGCATTATCCTGA
AA sequence
>Lus10032258 pacid=23168585 polypeptide=Lus10032258 locus=Lus10032258.g ID=Lus10032258.BGIv1.0 annot-version=v1.0
MASKANSTLALSLAINILFFSMVSAHCDCPNPTPNPNPKPTPTPRTPNPTPTPSSSSGKCPIDTLKLGVCANVLGNLLNIIIGSTPAKPCCSLISGLADL
DASSPLTHLLPPSSSQSSITVFTKSHQHPSSSSCLQAPSTAIIRLNHLTSSPSSSTVVTNRQSPPIIAAITMHPPPRQLRLLPTHQLVNASVTQPRQDQP
SQQRGSGARRPAPPTMQPPISVTPLTDAPATASPEILIPSVFALS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G12500 Bifunctional inhibitor/lipid-t... Lus10032258 0 1
Lus10016931 3.9 0.7905
AT5G05390 LAC12 laccase 12 (.1) Lus10009841 5.9 0.8111
AT1G19250 FMO1 flavin-dependent monooxygenase... Lus10005178 15.3 0.7620
AT2G35612 unknown protein Lus10034745 15.7 0.7487
AT5G52260 MYB ATMYB19 myb domain protein 19 (.1) Lus10005739 21.5 0.7072
AT1G06330 Heavy metal transport/detoxifi... Lus10013911 22.6 0.7838
Lus10028109 47.9 0.7296
AT3G57990 unknown protein Lus10000401 60.7 0.6616
AT5G16460 Putative adipose-regulatory pr... Lus10026836 65.1 0.6441
AT2G02990 RNS1, ATRNS1 ribonuclease 1 (.1) Lus10012823 72.8 0.7135

Lus10032258 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.