Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12510 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12550 76 / 3e-19 AIR1 Auxin-Induced in Root cultures 1 (.1) AT4G12545 71 / 7e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 70 / 4e-16 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G22460 65 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 66 / 3e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 64 / 4e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 63 / 2e-13 AZI1 azelaic acid induced 1 (.1) AT4G12490 63 / 3e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024626 [exp] 96 / 3e-26 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 94 / 2e-25 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10004348 [exp] 87 / 5e-23 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 81 / 3e-20 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 80 / 5e-20 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 79 / 1e-19 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024625 [exp] 76 / 9e-19 AT4G12520 158 / 5e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032260 [exp] 74 / 7e-18 AT4G12520 155 / 5e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032254 [exp] 74 / 1e-17 AT4G12520 139 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 83 / 1e-21 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 68 / 1e-15 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 67 / 3e-15 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 60 / 2e-12 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G121800 [exp] 59 / 4e-12 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G128800 [exp] 55 / 2e-10 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 56 / 4e-10 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 53 / 6e-10 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 51 / 2e-09 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G065500 [exp] 50 / 2e-08 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10032259 pacid=23168702 polypeptide=Lus10032259 locus=Lus10032259.g ID=Lus10032259.BGIv1.0 annot-version=v1.0 ATGGCAGCTTCCAAGACAAACTCAGCCCTGGCCATCTTCCTTGCCCTCAACCTTCTCTCCTCCTCCATGGTCTCGGCCCAAACCGGGAAATGCCCAGTCG ATACACTCAAGTTGGGCGTGTGCGCCAATGTGCTCGGTAGCTTGCTCAACCTCAACGTTGGGAATCCACCGGTCCAGCCCTGCTGCAGTTTGATCAACGG ACTGGTCGATCTTGAGGCTGCTCTTTGCCTTTGCACATCAATTAAACTCAACGTTCTCAACATCGTCAACCTCAACGTCCCCCTTTCTCTCAGCTTGCTT CTCAACGTCTGCAACAGAAAGGCGCCATCAGGCTTCCAATGCCCTCCTTGA
AA sequence Show only first row Show all	>Lus10032259 pacid=23168702 polypeptide=Lus10032259 locus=Lus10032259.g ID=Lus10032259.BGIv1.0 annot-version=v1.0 MAASKTNSALAIFLALNLLSSSMVSAQTGKCPVDTLKLGVCANVLGSLLNLNVGNPPVQPCCSLINGLVDLEAALCLCTSIKLNVLNIVNLNVPLSLSLL LNVCNRKAPSGFQCPP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032259 [exp]	0	1
AT5G14380		AGP6	arabinogalactan protein 6 (.1)		Lus10022309 [exp]	1.0	0.8130
AT5G57520	C2H2ZnF	ATZFP2, ZFP2	zinc finger protein 2 (.1)		Lus10006960 [exp]	1.4	0.7194
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10024705 [exp]	6.5	0.6633
AT3G22060			Receptor-like protein kinase-r...		Lus10012853 [exp]	7.3	0.6634
					Lus10000576 [exp]	7.7	0.6822
AT1G18010			Major facilitator superfamily ...		Lus10009413 [exp]	9.8	0.6890
AT1G08580			unknown protein		Lus10000388 [exp]	10.5	0.6718
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10007832 [exp]	11.5	0.6455
					Lus10005828 [exp]	14.0	0.6416
					Lus10017763 [exp]	24.1	0.6477

Compare expression of checked genes

Lus10032259 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.