Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12090 117 / 2e-34 ELP extensin-like protein (.1) AT1G62510 112 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 108 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 108 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 105 / 1e-29 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 102 / 2e-28 AZI1 azelaic acid induced 1 (.1) AT4G12500 101 / 7e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 100 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 99 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G22460 94 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024625 [exp] 124 / 3e-37 AT4G12520 158 / 5e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 120 / 2e-35 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 119 / 2e-35 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 117 / 1e-34 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10028929 [exp] 116 / 4e-34 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004348 [exp] 115 / 4e-34 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 114 / 1e-33 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024620 [exp] 115 / 4e-33 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032257 [exp] 112 / 1e-32 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 107 / 5e-31 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 105 / 5e-30 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 103 / 3e-29 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 92 / 4e-25 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 92 / 7e-25 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 89 / 1e-23 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 87 / 9e-23 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.013G128800 [exp] 76 / 1e-18 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 79 / 3e-18 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 72 / 2e-16 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10032260 pacid=23168495 polypeptide=Lus10032260 locus=Lus10032260.g ID=Lus10032260.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAAACCAACTCAGCCATGGCTCTCTTCCTTGCACTCAACCTCCTCTTCTTCTCCATGGCATCCGCCTGCGGTGGCGGATGCCCTACTCCGA AACCCAAACCCAAACCTAAACCCACTCCTTCCGGAGGAGGGAAATGCCCTGTCGATACCCTGAAACTGGGCGTGTGCGCTAACGTGCTTGGCTCATTGCT CAACCTTAACCTCGGGAAGCCACCGGTCGAGCCTTGTTGTAGCTTGCTCAATGGACTTGCTGATCTTGAGGCTGCTGTCTGCCTTTGCACTGCCATTAAA GCCAACATTCTTGGAATCAACCTTAACGTTCCGATTTCTCTCAGCTTGCTTCTCAACGTTTGTGACAAGAAGGCTCTGCCTGGCTTCCAGTGCCCTTGA
AA sequence Show only first row Show all	>Lus10032260 pacid=23168495 polypeptide=Lus10032260 locus=Lus10032260.g ID=Lus10032260.BGIv1.0 annot-version=v1.0 MASKTNSAMALFLALNLLFFSMASACGGGCPTPKPKPKPKPTPSGGGKCPVDTLKLGVCANVLGSLLNLNLGKPPVEPCCSLLNGLADLEAAVCLCTAIK ANILGINLNVPISLSLLLNVCDKKALPGFQCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032260 [exp]	0	1
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10024625 [exp]	2.8	0.8771
AT4G01330			Protein kinase superfamily pro...		Lus10041593 [exp]	6.7	0.8803
AT5G50335			unknown protein		Lus10001469 [exp]	7.3	0.8769
AT5G12250		TUB6	beta-6 tubulin (.1)		Lus10008528 [exp]	16.1	0.8633
AT3G05100			S-adenosyl-L-methionine-depend...		Lus10001712 [exp]	18.0	0.7958
AT1G04040			HAD superfamily, subfamily III...		Lus10011774 [exp]	18.2	0.8668
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10024854 [exp]	19.3	0.8747
AT3G24670			Pectin lyase-like superfamily ...		Lus10022817 [exp]	19.4	0.8578
AT5G42320			Zn-dependent exopeptidases sup...		Lus10012267 [exp]	22.8	0.8457
AT1G15370			SNARE-like superfamily protein...		Lus10002016 [exp]	24.4	0.8203

Compare expression of checked genes

Lus10032260 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.