Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62510 135 / 1e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 134 / 7e-41 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 130 / 2e-39 AZI1 azelaic acid induced 1 (.1) AT1G12090 129 / 4e-39 ELP extensin-like protein (.1) AT4G12500 127 / 3e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 126 / 3e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 126 / 3e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 126 / 1e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 112 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G22460 106 / 2e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024626 [exp] 160 / 3e-51 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004348 [exp] 144 / 5e-45 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 141 / 7e-44 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 139 / 3e-43 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 130 / 5e-40 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 132 / 6e-40 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024620 [exp] 126 / 2e-37 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032257 [exp] 124 / 4e-37 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024621 [exp] 123 / 3e-36 AT4G12490 147 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G121900 [exp] 134 / 3e-41 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 132 / 1e-40 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 130 / 6e-40 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 107 / 1e-30 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 101 / 2e-28 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 100 / 7e-28 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 99 / 1e-27 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.013G128800 [exp] 90 / 1e-23 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 92 / 4e-23 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 86 / 1e-21 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10032261 pacid=23168631 polypeptide=Lus10032261 locus=Lus10032261.g ID=Lus10032261.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAAACCCACTCAACTTTGGCCATTTTCCTAGCCATCAACCTCCTCTTCTTCACCATGGTCTCCGCCACCAAAAAACCAGGCTGCCCACCAC CGCCACCTAAGCCCACCAAATGCCCGCCACCGCCCTCGAAACCAACCCCAACTCCTAGCCCTTCATCCAACAAATGCCCCATCGACGCCCTCAAGTTGGG CGTCTGTGCCAACGTGCTTAGCTCGCTCCTCAACATCACCATCGGAAAGCCACCCGTTAAGCCCTGCTGCAGCTTAATCGACGGTCTTGTCGATCTCGAG GCTGCTCTTTGCCTCTGCACTGCAATCAAAGCCAACATTCTCGGGATCCACCTCAACGTCCCGATTTCTCTCAGCTTGCTTCTTAACGTGTGTACCAAGA AGGTCCCATCCGGCTTCCAGTGCCCTTGA
AA sequence Show only first row Show all	>Lus10032261 pacid=23168631 polypeptide=Lus10032261 locus=Lus10032261.g ID=Lus10032261.BGIv1.0 annot-version=v1.0 MASKTHSTLAIFLAINLLFFTMVSATKKPGCPPPPPKPTKCPPPPSKPTPTPSPSSNKCPIDALKLGVCANVLSSLLNITIGKPPVKPCCSLIDGLVDLE AALCLCTAIKANILGIHLNVPISLSLLLNVCTKKVPSGFQCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12470		AZI1	azelaic acid induced 1 (.1)		Lus10032261 [exp]	0	1
AT2G02061			Nucleotide-diphospho-sugar tra...		Lus10031903 [exp]	1.7	0.9554
AT2G24400			SAUR-like auxin-responsive pro...		Lus10035716 [exp]	2.2	0.9644
AT5G42500			Disease resistance-responsive ...		Lus10021084 [exp]	3.3	0.9350
AT1G53130		GRI	GRIM REAPER, Stigma-specific S...		Lus10005544 [exp]	7.5	0.9570
AT2G02310		ATPP2-B6	phloem protein 2-B6 (.1)		Lus10003445 [exp]	8.9	0.9212
AT5G51480		SKS2	SKU5 similar 2 (.1)		Lus10038920 [exp]	10.0	0.9503
AT2G23630		SKS16	SKU5 similar 16 (.1)		Lus10000837 [exp]	11.5	0.9304
AT1G75717			unknown protein		Lus10033147 [exp]	15.7	0.8911
AT2G42850		CYP718	"cytochrome P450, family 718",...		Lus10010940 [exp]	16.1	0.9422
AT5G51490			Plant invertase/pectin methyle...		Lus10038919 [exp]	19.0	0.9378

Compare expression of checked genes

Lus10032261 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.