Lus10032262 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62500 130 / 4e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G10940 97 / 2e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT3G22142 96 / 5e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G15160 86 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT3G22120 86 / 3e-19 CWLP cell wall-plasma membrane linker protein (.1)
AT4G12470 63 / 3e-12 AZI1 azelaic acid induced 1 (.1)
AT4G12480 62 / 2e-11 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12490 62 / 2e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G62510 61 / 2e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12500 61 / 3e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028930 131 / 2e-37 AT1G62500 141 / 4e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004349 118 / 3e-32 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010482 92 / 8e-24 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10003801 95 / 1e-22 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010479 91 / 3e-21 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10027704 87 / 1e-20 AT2G10940 135 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10001493 72 / 7e-16 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10003802 72 / 2e-14 ND 127 / 5e-33
Lus10010480 69 / 4e-14 ND 127 / 3e-34
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G111300 123 / 6e-34 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G065500 110 / 1e-29 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.018G126000 108 / 2e-27 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.006G008500 96 / 3e-24 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
Potri.016G015500 99 / 2e-23 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G008300 94 / 5e-23 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.008G135860 86 / 7e-20 AT1G62500 75 / 7e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.018G025900 70 / 5e-15 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121900 67 / 1e-13 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G111400 64 / 8e-13 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10032262 pacid=23168581 polypeptide=Lus10032262 locus=Lus10032262.g ID=Lus10032262.BGIv1.0 annot-version=v1.0
ATGGAGGCGGCGGCCACACTCCAACCCGCCCTAGCCCCGTCATTCCCCATCCTCCTCATCATGGTGGCGGTGGCGGCGGAGGTGGCAGTGGTGGAGGACA
TGGAGGTGGTGGTACATGGGGGTGGCGGTGGTGGAGGACATGGAGGTGGCGGTGGTGGAGGACATGGAGGTGGTGGATCAGGAGGCAAAGGACATAATCC
ACCGTCAATGGGCCCACCCATGCCACCCATAATCCTACCTCCGATCACAAATCCCCCGGTCAGACCTCCTCCGGTGGTCAACCCTCCACCATTCACAAAC
CCTCCGTTCATCAACCCTCCTCCGATCATAAACCCGCCGGTGGGCAACCCCCCGCCGCTCCCCAAACAAGCACCNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNACCTCCGTTTCTCACCCCAGCGCCACCTTGCTCCAGCTGCCCGACCAGCGGTGGTGGTGGAGGCGGAGGAGGTGGCGGCGGGGG
AGGCGGCGGAGGTGGAGGTACACCTCCATCAAAGCAACCAAAGTGTCCTATCAACGCGCTTAAGCTAGGCGCGTGCGTGGACGTGCTGGGAGGTTTGGTC
CACATAGGGCTAGGGGATCCGGTCGAGAACGTCTGCTGCCCGGTTCTGCAAGGGTTGCTTGAGCTGGAAGCCGCCGTTTGCTTGTGCACAACGCTAAGGC
TGAAGCTTCTGAATCTCAACATCTTCATTCCTTTGGCTCTTCAGGCTCTCATCACCTGCGGCAAGACTCCTCCACCTGGCTTCGTCTGTCCTCCTCTCTG
A
AA sequence
>Lus10032262 pacid=23168581 polypeptide=Lus10032262 locus=Lus10032262.g ID=Lus10032262.BGIv1.0 annot-version=v1.0
MEAAATLQPALAPSFPILLIMVAVAAEVAVVEDMEVVVHGGGGGGGHGGGGGGGHGGGGSGGKGHNPPSMGPPMPPIILPPITNPPVRPPPVVNPPPFTN
PPFINPPPIINPPVGNPPPLPKQAXXXXXXXXXXXXXXXPPFLTPAPPCSSCPTSGGGGGGGGGGGGGGGGGGTPPSKQPKCPINALKLGACVDVLGGLV
HIGLGDPVENVCCPVLQGLLELEAAVCLCTTLRLKLLNLNIFIPLALQALITCGKTPPPGFVCPPL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62500 Bifunctional inhibitor/lipid-t... Lus10032262 0 1
AT5G40830 ATRAD3, ATATR S-adenosyl-L-methionine-depend... Lus10007385 1.4 0.9731
Lus10042887 2.0 0.9721
AT2G45290 Transketolase (.1) Lus10004750 2.4 0.9669
AT3G54250 GHMP kinase family protein (.1... Lus10034147 4.5 0.9619
AT5G54970 unknown protein Lus10032643 4.6 0.9508
AT4G27585 SPFH/Band 7/PHB domain-contain... Lus10015597 7.3 0.9538
AT1G65900 unknown protein Lus10007381 7.5 0.9489
AT5G45590 Ribosomal protein L35 (.1) Lus10012140 10.2 0.9387
AT5G48490 Bifunctional inhibitor/lipid-t... Lus10038233 10.7 0.9552
AT2G34650 ABR, PID PINOID, ABRUPTUS, Protein kina... Lus10036150 13.6 0.9152

Lus10032262 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.