Lus10032265 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05530 54 / 3e-09 RING/U-box superfamily protein (.1)
AT3G19950 54 / 3e-09 RING/U-box superfamily protein (.1)
AT1G74620 54 / 3e-09 RING/U-box superfamily protein (.1)
AT1G55530 54 / 5e-09 RING/U-box superfamily protein (.1)
AT5G56340 54 / 6e-09 ATCRT1 RING/U-box superfamily protein (.1)
AT5G15820 52 / 2e-08 RING/U-box superfamily protein (.1)
AT4G12140 51 / 2e-08 RING/U-box superfamily protein (.1)
AT1G65040 52 / 3e-08 AtHrd1B homolog of yeast Hrd1, RING/U-box superfamily protein (.1.2.3)
AT3G13430 51 / 3e-08 RING/U-box superfamily protein (.1.2.3)
AT3G16090 51 / 5e-08 AtHrd1A homolog of yeast Hrd1, RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024629 213 / 5e-72 AT5G05530 54 / 2e-09 RING/U-box superfamily protein (.1)
Lus10020258 59 / 1e-10 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3)
Lus10002637 56 / 1e-09 AT1G55530 257 / 4e-82 RING/U-box superfamily protein (.1)
Lus10013397 54 / 6e-09 AT5G56340 330 / 5e-111 RING/U-box superfamily protein (.1)
Lus10040389 53 / 1e-08 AT2G37150 191 / 1e-53 RING/U-box superfamily protein (.1.2.3)
Lus10023477 53 / 1e-08 AT3G16090 650 / 0.0 homolog of yeast Hrd1, RING/U-box superfamily protein (.1)
Lus10012819 50 / 6e-08 AT1G26800 182 / 6e-58 RING/U-box superfamily protein (.1)
Lus10008874 51 / 7e-08 AT5G08139 198 / 3e-59 RING/U-box superfamily protein (.1)
Lus10037170 50 / 7e-08 AT1G26800 128 / 5e-37 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G074014 57 / 3e-10 AT3G19950 278 / 5e-93 RING/U-box superfamily protein (.1)
Potri.005G090500 55 / 1e-09 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1)
Potri.019G032500 54 / 5e-09 AT5G56340 177 / 1e-51 RING/U-box superfamily protein (.1)
Potri.018G034400 53 / 1e-08 AT4G32600 464 / 7e-162 RING/U-box superfamily protein (.1)
Potri.015G047900 53 / 1e-08 AT5G08139 201 / 3e-60 RING/U-box superfamily protein (.1)
Potri.010G245801 51 / 1e-08 AT2G27940 61 / 1e-11 RING/U-box superfamily protein (.1)
Potri.005G062400 52 / 2e-08 AT1G60360 82 / 3e-18 RING/U-box superfamily protein (.1)
Potri.012G036700 52 / 2e-08 AT3G19950 273 / 5e-90 RING/U-box superfamily protein (.1)
Potri.001G001500 52 / 3e-08 AT5G56340 323 / 2e-108 RING/U-box superfamily protein (.1)
Potri.007G107000 51 / 3e-08 AT1G18760 79 / 7e-18 Zinc finger, C3HC4 type (RING finger) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10032265 pacid=23168506 polypeptide=Lus10032265 locus=Lus10032265.g ID=Lus10032265.BGIv1.0 annot-version=v1.0
ATGGCAATGTCATACTTCCCCTCCTTCATCGCACTCGATCCGGATGACGACGACGACGACCAACCCGAACCCGAAGAGGATCTCTACAACAACGGCACTA
TTATTCCTCATCTTCCCATGGCGACTGACGATATGCCGCCGAAACGTCGCCTCCAGCCGCTGTTCGACGGCCACCTGGACGACGTGACGTCGTTCACCAC
CGAGGAACTACTGGACCCCAACTTGGACTGCTCCGTTTGTCTGGACAGTATCCAGTACAGCAACGACGACTACCCCGTGGGGTCAACGTCCGTGAAGAAG
CTGGCGTGCTGCCACGTGTTCCACGAGGATTGCATCCGCCGCTGGCTCGCCGTGAAAGCTTCTTGCCCTCTGTGCCGCCTGCCCGTACCCTCCGTTGGTG
GGACCTCCGCATTACGGAGCTTTTTGTTTAGATGGCTGTGTGTTGATTCTTGA
AA sequence
>Lus10032265 pacid=23168506 polypeptide=Lus10032265 locus=Lus10032265.g ID=Lus10032265.BGIv1.0 annot-version=v1.0
MAMSYFPSFIALDPDDDDDDQPEPEEDLYNNGTIIPHLPMATDDMPPKRRLQPLFDGHLDDVTSFTTEELLDPNLDCSVCLDSIQYSNDDYPVGSTSVKK
LACCHVFHEDCIRRWLAVKASCPLCRLPVPSVGGTSALRSFLFRWLCVDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G19950 RING/U-box superfamily protein... Lus10032265 0 1
AT4G12420 SKU5 Cupredoxin superfamily protein... Lus10037941 6.0 0.7544
AT2G23540 GDSL-like Lipase/Acylhydrolase... Lus10030684 6.4 0.8387
AT5G52790 CBS domain-containing protein ... Lus10036040 9.3 0.7636
AT4G29680 Alkaline-phosphatase-like fami... Lus10007981 12.0 0.7829
AT2G16430 ATPAP10, PAP10 purple acid phosphatase 10 (.1... Lus10028798 19.1 0.7535
AT2G33060 AtRLP27 receptor like protein 27 (.1) Lus10004313 25.0 0.7331
AT2G01690 ARM repeat superfamily protein... Lus10003679 26.3 0.7180
AT5G13660 unknown protein Lus10005963 28.3 0.7149
Lus10006164 30.0 0.7149
AT4G17810 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers sup... Lus10000481 31.6 0.7149

Lus10032265 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.