Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23330 116 / 3e-34 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024630 [exp] 154 / 3e-49 AT4G23330 136 / 8e-42 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G103800 [exp] 127 / 2e-38 AT4G23330 174 / 1e-56 unknown protein Potri.003G127900 [exp] 68 / 3e-15 AT4G23330 57 / 4e-11 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032266 pacid=23168566 polypeptide=Lus10032266 locus=Lus10032266.g ID=Lus10032266.BGIv1.0 annot-version=v1.0 ATGGAAGGCGGTGGAGGAGGAGAGACAATCGAGGAGCTGACGGAGCTTGTCCAATCGGTTGACGGTTCGGAAGTGGCCGATGGGAGTGGTGAGAAGGTGG TGAATCGGAGGGAAATAGTTAAGGCTGTGGAAGTTGTGGAGAAGGATTCACTGGCGATCGCCGAGAGTTTCACCGATCTCTTCTCATCTCTCAGATCCGC GCTCTCCGAGGCTACAACAAGCTCGGTCGATCATATGCAGTGCTTCAGCGATGCCACAGGCAGGCTTCAAGAGTCAGTACTTGATGCAGCTACAAAGGGT AATCGCTACATCAATTCATGTCTCAGGGCAAGATCAAGTCTAGCAGTATTTCTTGCTCCTAATAATGGAGATGTTCACAGAAGTTAG
AA sequence Show only first row Show all	>Lus10032266 pacid=23168566 polypeptide=Lus10032266 locus=Lus10032266.g ID=Lus10032266.BGIv1.0 annot-version=v1.0 MEGGGGGETIEELTELVQSVDGSEVADGSGEKVVNRREIVKAVEVVEKDSLAIAESFTDLFSSLRSALSEATTSSVDHMQCFSDATGRLQESVLDAATKG NRYINSCLRARSSLAVFLAPNNGDVHRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23330			unknown protein		Lus10032266 [exp]	0	1
AT1G29530			unknown protein		Lus10015254 [exp]	2.2	0.8193
AT4G14540	CCAAT	NF-YB3	"nuclear factor Y, subunit B3"...		Lus10001751 [exp]	3.0	0.8000
AT2G29960		CYP19-4, ATCYP5...	CYCLOPHILIN 19-4, ARABIDOPSIS ...		Lus10014846 [exp]	3.2	0.8097
AT4G09620			Mitochondrial transcription te...		Lus10009420 [exp]	6.9	0.7998
AT3G21740		APO4	ACCUMULATION OF PHOTOSYSTEM ON...		Lus10027182 [exp]	8.7	0.7326
AT5G03440			unknown protein		Lus10026537 [exp]	8.9	0.7448
AT4G14540	CCAAT	NF-YB3	"nuclear factor Y, subunit B3"...		Lus10001177 [exp]	9.8	0.7840
AT3G16190			Isochorismatase family protein...		Lus10006833 [exp]	10.2	0.7959
AT3G12350			F-box family protein (.1.2)		Lus10010607 [exp]	11.5	0.7677
AT1G52740		HTA9	histone H2A protein 9 (.1)		Lus10019449 [exp]	14.1	0.7610

Compare expression of checked genes

Lus10032266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.