Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78190 186 / 3e-62 Trm112p-like protein (.1) AT1G22270 156 / 2e-50 Trm112p-like protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024634 [exp] 235 / 1e-81 AT1G78190 187 / 8e-63 Trm112p-like protein (.1) Lus10017505 [exp] 207 / 1e-70 AT1G78190 175 / 6e-58 Trm112p-like protein (.1) Lus10028778 [exp] 186 / 8e-56 AT5G45140 1711 / 0.0 nuclear RNA polymerase C2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G165000 [exp] 204 / 1e-69 AT1G22270 165 / 4e-54 Trm112p-like protein (.1) Potri.002G096600 [exp] 182 / 1e-60 AT1G22270 169 / 2e-55 Trm112p-like protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF03966 [flax] [poplar] Trm112p Trm112p-like protein
Representative CDS sequence Show only first row Show all	>Lus10032269 pacid=23168640 polypeptide=Lus10032269 locus=Lus10032269.g ID=Lus10032269.BGIv1.0 annot-version=v1.0 ATGAGGCTACTGACTCACAACATGCTTTCCTCCAATATCAAAGGAGTCGTCAACGGGTTCCCGCTCCGGATCGAGGCGGTGAAAGTCATCGAGAAGGAAG TCGATCTCAACCCCGACTTCCTCCGCAACATCTTCCCCAAGATCGAGTGGAAGCCACTCGCCGACGCCGCGCGTGCCGTTGGGTACTCGGAGCTCCCGGA GGCGGCGGATGAGTCGATGCTGGAGTCGGAGGAGTTTCTGGGGAAGTTCCACCACGCGCTGCTGGAGATCCACTTGGAGGAAGGCGCTCTGGTCTGCCCC GAAACTGGGCGGAAGTTCTCGGTTAATAAAGGGATCCCCAATATGCTCCTCCATGAGGATGAGGTTTAG
AA sequence Show only first row Show all	>Lus10032269 pacid=23168640 polypeptide=Lus10032269 locus=Lus10032269.g ID=Lus10032269.BGIv1.0 annot-version=v1.0 MRLLTHNMLSSNIKGVVNGFPLRIEAVKVIEKEVDLNPDFLRNIFPKIEWKPLADAARAVGYSELPEAADESMLESEEFLGKFHHALLEIHLEEGALVCP ETGRKFSVNKGIPNMLLHEDEV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G78190			Trm112p-like protein (.1)		Lus10032269 [exp]	0	1
AT3G58660			Ribosomal protein L1p/L10e fam...		Lus10005380 [exp]	7.0	0.7468
AT2G47990		SWA1, EDA13, ED...	SLOW WALKER1, EMBRYO SAC DEVEL...		Lus10017890 [exp]	7.5	0.7430
AT1G78190			Trm112p-like protein (.1)		Lus10024634 [exp]	7.7	0.6920
AT1G54850			HSP20-like chaperones superfam...		Lus10035725 [exp]	13.7	0.7219
AT1G80860		ATPLMT	ARABIDOPSIS PHOSPHOLIPID N-MET...		Lus10026087 [exp]	14.0	0.6940
AT3G58660			Ribosomal protein L1p/L10e fam...		Lus10024134 [exp]	15.6	0.7049
AT1G73770			unknown protein		Lus10013498 [exp]	18.3	0.6676
AT5G40190			RNA ligase/cyclic nucleotide p...		Lus10032164 [exp]	31.9	0.6849
AT5G02380		MT2B	metallothionein 2B (.1)		Lus10024396 [exp]	34.6	0.6213
AT1G07920			GTP binding Elongation factor ...		Lus10019918 [exp]	34.6	0.6767

Compare expression of checked genes

Lus10032269 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.