Lus10032274 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G63800 262 / 1e-90 UBC5 ubiquitin-conjugating enzyme 5 (.1)
AT5G41340 258 / 4e-89 ATUBC4, UBC4 ubiquitin conjugating enzyme 4 (.1)
AT2G46030 241 / 3e-82 UBC6 ubiquitin-conjugating enzyme 6 (.1)
AT1G64230 95 / 3e-25 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G56150 94 / 5e-25 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT3G08690 94 / 1e-24 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT4G27960 93 / 2e-24 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G41700 92 / 3e-24 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT3G08700 92 / 4e-24 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT5G53300 91 / 1e-23 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014763 261 / 4e-90 AT1G63800 294 / 6e-103 ubiquitin-conjugating enzyme 5 (.1)
Lus10024638 257 / 1e-88 AT1G63800 229 / 2e-77 ubiquitin-conjugating enzyme 5 (.1)
Lus10036372 251 / 5e-86 AT1G63800 286 / 9e-100 ubiquitin-conjugating enzyme 5 (.1)
Lus10002359 247 / 4e-84 AT1G63800 275 / 5e-95 ubiquitin-conjugating enzyme 5 (.1)
Lus10042136 245 / 6e-84 AT1G63800 267 / 2e-92 ubiquitin-conjugating enzyme 5 (.1)
Lus10009422 96 / 2e-25 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10028700 96 / 2e-25 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10022726 94 / 6e-25 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 94 / 6e-25 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G101900 287 / 1e-100 AT5G41340 292 / 3e-102 ubiquitin conjugating enzyme 4 (.1)
Potri.003G129700 278 / 5e-97 AT5G41340 284 / 5e-99 ubiquitin conjugating enzyme 4 (.1)
Potri.002G161000 275 / 1e-95 AT1G63800 288 / 1e-100 ubiquitin-conjugating enzyme 5 (.1)
Potri.014G086600 270 / 8e-94 AT1G63800 283 / 8e-99 ubiquitin-conjugating enzyme 5 (.1)
Potri.015G073400 244 / 2e-83 AT5G41340 268 / 1e-92 ubiquitin conjugating enzyme 4 (.1)
Potri.019G083800 97 / 3e-26 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2)
Potri.003G136200 95 / 4e-25 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 94 / 5e-25 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.011G168200 94 / 6e-25 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G094900 94 / 6e-25 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10032274 pacid=23168603 polypeptide=Lus10032274 locus=Lus10032274.g ID=Lus10032274.BGIv1.0 annot-version=v1.0
ATGATGAGTGATTACAAGGTGGAGATGATCAATGATGGCATGCAAGAGTTCTTCGTGGAGTTCCATGGACCAAAAGACAGTCCTTACCAAGAAGGAATGT
GGAAGATAAGAGTGGAATTACCAGATGCTTATCCTTATAAGTCTCCATCCATTGGATTTATTAACAAGATCTACCACCCAAACGTGGATGAAATGTCGGG
TTCGGTTTGCTTGGATGTTATCAATCAAACTTGGAGCCCGATGTTTGATTTGGTGAATGTATTTGAAGTGTTTCTTCCTCAGCTTCTTTTGTACCCCAAT
CCATCGGATCCTTTGAATGGAGAAGCTGCTGCTTTGATGATGCGTGATCGTACTGCTTATGACCAAAGAGTGAAAGAGTATTGCGAAAAGTACGCAAGGC
CGGAGGACATTGGGGCAAAACCAGAAGATGAATCGAGCGAGGAGGAGCTGAGTGAAGCTGATGAATATGGCTCCGAGGATGATCAAATTGCAGGAAAAGC
TGATCCCTGA
AA sequence
>Lus10032274 pacid=23168603 polypeptide=Lus10032274 locus=Lus10032274.g ID=Lus10032274.BGIv1.0 annot-version=v1.0
MMSDYKVEMINDGMQEFFVEFHGPKDSPYQEGMWKIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPN
PSDPLNGEAAALMMRDRTAYDQRVKEYCEKYARPEDIGAKPEDESSEEELSEADEYGSEDDQIAGKADP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G63800 UBC5 ubiquitin-conjugating enzyme 5... Lus10032274 0 1
AT5G58220 ALNS, TTL allantoin synthase, transthyre... Lus10025696 1.0 0.9584
AT3G52220 unknown protein Lus10039101 1.7 0.9483
AT1G02305 Cysteine proteinases superfami... Lus10007212 2.4 0.9550
AT5G02270 ABCI20, ATNAP9 ARABIDOPSIS THALIANA NON-INTRI... Lus10010838 3.2 0.9373
AT3G22845 emp24/gp25L/p24 family/GOLD fa... Lus10039381 3.7 0.9415
AT5G09260 VPS20.2 vacuolar protein sorting-assoc... Lus10015693 4.2 0.9392
AT1G02305 Cysteine proteinases superfami... Lus10010091 4.4 0.9283
AT3G49420 Got1/Sft2-like vescicle transp... Lus10026704 4.6 0.9273
AT2G32760 unknown protein Lus10016662 4.7 0.9361
AT1G44170 ALDH4, ALDH3H1 aldehyde dehydrogenase 4, alde... Lus10042724 6.2 0.9343

Lus10032274 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.