Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11480 88 / 7e-22 BSMT1, ATBSMT1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT3G21950 87 / 1e-21 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT5G04380 80 / 5e-19 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT5G04370 80 / 7e-19 NAMT1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) AT5G38020 78 / 4e-18 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT5G66430 77 / 6e-18 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT2G14060 75 / 4e-17 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT4G36470 72 / 6e-16 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT1G19640 72 / 6e-16 JMT jasmonic acid carboxyl methyltransferase (.1) AT5G55250 44 / 4e-06 AtIAMT1, IAMT1 IAA carboxylmethyltransferase 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024671 [exp] 162 / 8e-50 AT5G66430 280 / 2e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10041380 [exp] 119 / 2e-33 AT4G36470 278 / 4e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10025993 [exp] 107 / 9e-29 AT1G19640 288 / 1e-93 jasmonic acid carboxyl methyltransferase (.1) Lus10036548 [exp] 100 / 1e-25 AT5G66430 250 / 1e-77 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10036550 [exp] 90 / 1e-22 AT3G11480 249 / 8e-80 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10036547 [exp] 84 / 2e-20 AT5G66430 243 / 1e-77 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10041776 [exp] 69 / 6e-15 AT4G36470 421 / 3e-147 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10024271 [exp] 68 / 1e-14 AT1G19640 315 / 2e-105 jasmonic acid carboxyl methyltransferase (.1) Lus10032569 [exp] 49 / 9e-08 AT5G55250 400 / 2e-139 IAA carboxylmethyltransferase 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G021300 [exp] 109 / 8e-30 AT3G11480 318 / 1e-106 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G022400 [exp] 86 / 6e-21 AT3G11480 311 / 4e-104 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G022002 [exp] 86 / 6e-21 AT3G11480 309 / 3e-103 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G022000 [exp] 83 / 4e-20 AT3G11480 300 / 7e-100 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.007G021400 [exp] 72 / 6e-16 AT4G36470 469 / 4e-166 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.005G230100 [exp] 68 / 1e-14 AT1G19640 389 / 1e-134 jasmonic acid carboxyl methyltransferase (.1) Potri.005G045900 [exp] 65 / 2e-13 AT1G19640 271 / 3e-88 jasmonic acid carboxyl methyltransferase (.1) Potri.019G022200 [exp] 61 / 3e-12 AT5G04370 227 / 1e-71 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Potri.019G022402 [exp] 61 / 4e-12 AT3G11480 261 / 1e-84 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.017G123000 [exp] 39 / 0.0001 AT5G37990 249 / 9e-81 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF03492 [flax] [poplar] Methyltransf_7 SAM dependent carboxyl methyltransferase
Representative CDS sequence Show only first row Show all	>Lus10032299 pacid=23168504 polypeptide=Lus10032299 locus=Lus10032299.g ID=Lus10032299.BGIv1.0 annot-version=v1.0 ATGGATGAATCGTCGGCAATGTTCTTCAACGGGCCTGCATTGGCTGTCTCTCGGGTTCCTGACAGGCTGGAGGAAAACAGAGGGAATGTTACGATAACTG GTCGTAGCCCTCGGAGTGTTTTTGAAGCATATTACGGTCAGTTCAGGAAAGACTTTTCGATGTTCTTGAAGTGCCAAGCTCTGGAGATGGTTAAAGGTGG ACGGATGGTTCTGACATTGCTGGGCAGGAGAAATGAAGACATCGGAGGCAGAGAATGTTACTACATTTGGGAGCTCATCTCAATGGTCCTAACTCAACAC GATCATTCCGAACTCTAA
AA sequence Show only first row Show all	>Lus10032299 pacid=23168504 polypeptide=Lus10032299 locus=Lus10032299.g ID=Lus10032299.BGIv1.0 annot-version=v1.0 MDESSAMFFNGPALAVSRVPDRLEENRGNVTITGRSPRSVFEAYYGQFRKDFSMFLKCQALEMVKGGRMVLTLLGRRNEDIGGRECYYIWELISMVLTQH DHSEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Lus10032299 [exp]	0	1
					Lus10002237 [exp]	1.0	0.9983
AT1G64870			unknown protein		Lus10041678 [exp]	1.7	0.9675
AT1G68630			PLAC8 family protein (.1)		Lus10009036 [exp]	2.0	0.9821
AT3G29970			B12D protein (.1)		Lus10035132 [exp]	2.2	0.9461
AT1G62935			unknown protein		Lus10009297 [exp]	3.5	0.9464
					Lus10010306 [exp]	4.2	0.9460
AT2G29670			Tetratricopeptide repeat (TPR)...		Lus10043203 [exp]	4.4	0.8401
AT3G26880			Plant self-incompatibility pro...		Lus10038164 [exp]	7.9	0.8997
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Lus10028473 [exp]	9.2	0.8605
AT3G11080		AtRLP35	receptor like protein 35 (.1)		Lus10004307 [exp]	9.2	0.8507

Compare expression of checked genes

Lus10032299 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.