Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16916 66 / 3e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024703 [exp] 120 / 3e-37 AT1G16916 66 / 3e-15 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G109100 [exp] 61 / 2e-14 AT1G16916 78 / 4e-21 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032325 pacid=23168681 polypeptide=Lus10032325 locus=Lus10032325.g ID=Lus10032325.BGIv1.0 annot-version=v1.0 ATGGAAGAGGTAGCAGGCCCCCCTGGGCCGAAGATCGTTCGTGTTCTGTATTTCGCCGGCGCCGGAGTACTCTTGACTTTCGCCATCAACAAGTGGAAAG AGATCGAGAGGAACTCGATCAAGAAGCAACATGGAGTTCGCGATTCCGCCAAAGTGGTACCCAAACCAGCGAATTGA
AA sequence Show only first row Show all	>Lus10032325 pacid=23168681 polypeptide=Lus10032325 locus=Lus10032325.g ID=Lus10032325.BGIv1.0 annot-version=v1.0 MEEVAGPPGPKIVRVLYFAGAGVLLTFAINKWKEIERNSIKKQHGVRDSAKVVPKPAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G16916			unknown protein		Lus10032325 [exp]	0	1
AT4G13530			unknown protein		Lus10003531 [exp]	1.4	0.8700
AT3G18430			Calcium-binding EF-hand family...		Lus10022173 [exp]	1.4	0.8600
AT2G15560			Putative endonuclease or glyco...		Lus10019845 [exp]	4.0	0.8092
					Lus10032936 [exp]	8.5	0.7675
AT5G51410			LUC7 N_terminus domain-contain...		Lus10031156 [exp]	8.8	0.8420
AT4G19985			Acyl-CoA N-acyltransferases (N...		Lus10028990 [exp]	9.2	0.8401
AT5G66200		ARO2	armadillo repeat only 2 (.1)		Lus10036897 [exp]	10.4	0.7957
AT2G44880			Pentatricopeptide repeat (PPR-...		Lus10026886 [exp]	12.0	0.7874
AT4G31580		SRZ22, RSZP22, ...	RS-containing zinc finger prot...		Lus10020123 [exp]	17.0	0.7977
					Lus10042562 [exp]	19.6	0.8301

Compare expression of checked genes

Lus10032325 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.