Lus10032331 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64160 175 / 4e-56 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G23690 174 / 2e-55 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11210 157 / 7e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11190 147 / 7e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11180 138 / 2e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21110 62 / 5e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 61 / 9e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 61 / 1e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 61 / 1e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13662 60 / 2e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024715 339 / 7e-121 AT4G23690 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10024714 327 / 9e-116 AT4G23690 186 / 3e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017538 246 / 7e-84 AT4G23690 187 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10028749 172 / 1e-54 AT1G64160 232 / 2e-78 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017539 166 / 2e-52 AT1G64160 238 / 9e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 74 / 3e-16 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 70 / 5e-15 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 70 / 6e-15 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 69 / 9e-15 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G142602 290 / 2e-101 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096800 290 / 2e-101 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134800 290 / 4e-101 AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142501 285 / 1e-99 AT1G64160 179 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096680 285 / 2e-99 AT1G64160 178 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134600 275 / 1e-95 AT1G64160 182 / 5e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142702 250 / 1e-85 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G097001 250 / 1e-85 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134400 207 / 8e-69 AT1G64160 184 / 1e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096440 194 / 3e-64 AT1G64160 119 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10032331 pacid=23168601 polypeptide=Lus10032331 locus=Lus10032331.g ID=Lus10032331.BGIv1.0 annot-version=v1.0
ATGGCTATCTCAAGAAGCAACATTGCTCTCTTCTTCATCTTCTTCATCTGCCTTTCCTCTGCCAACTCTTCAGCCAAGAAGAAGCAACACACTCCATGCA
AGGAGCTAGTACTCTTCTTCCACGACATCATCTACAATGGGCATAACAAGGCCAATGCCACGGCGGCCATCGTGGCTGCTCCCGAGGGCGCCAACCGGAC
CATCCTTGCCGGCGAGTTCCATTTCGGGAACATAGCCGTGTTCGACGACCCGATCACCCTCGACAACAACCTGCACTCCCCGCCCGTCGGCAGGGCCCAG
GGGATGTACCTGTACGACACGAAGAACACGTTTACTGCCTGGCTAGGCTTCACTTTTTCTCTCAACAGCACCGAGCACCAAGGCACGATTAACTTCATGG
GAGCCGACCCGCTTATGAACAAGACTAGGGATGTGTCGATTGTTGGCGGGACCGGCGACTTCTTTATGCACCGTGGGGTGGCGACCATCATGACGGACTC
GTATGAAGGTGAAGTGTACTTTAGACTTCGAGTTGACATGAAATTTTACGATTGTTGGTGA
AA sequence
>Lus10032331 pacid=23168601 polypeptide=Lus10032331 locus=Lus10032331.g ID=Lus10032331.BGIv1.0 annot-version=v1.0
MAISRSNIALFFIFFICLSSANSSAKKKQHTPCKELVLFFHDIIYNGHNKANATAAIVAAPEGANRTILAGEFHFGNIAVFDDPITLDNNLHSPPVGRAQ
GMYLYDTKNTFTAWLGFTFSLNSTEHQGTINFMGADPLMNKTRDVSIVGGTGDFFMHRGVATIMTDSYEGEVYFRLRVDMKFYDCW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G23690 Disease resistance-responsive ... Lus10032331 0 1
AT5G38210 Protein kinase family protein ... Lus10028495 3.9 0.9791
AT1G63970 MECPS, ISPF 2C-METHYL-D-ERYTHRITOL 2,4-CYC... Lus10028759 5.0 0.9822
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10013593 5.1 0.9804
Lus10012705 11.9 0.9523
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10021258 12.0 0.9770
AT1G13080 CYP71B2 "cytochrome P450, family 71, s... Lus10043312 12.5 0.9787
AT1G60690 NAD(P)-linked oxidoreductase s... Lus10023701 13.2 0.9782
AT3G52450 PUB22 plant U-box 22 (.1) Lus10029393 14.1 0.9708
AT3G12910 NAC NAC (No Apical Meristem) domai... Lus10036194 16.0 0.9602
AT1G06000 UDP-Glycosyltransferase superf... Lus10007971 16.1 0.9765

Lus10032331 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.