Lus10032333 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G41650 196 / 1e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1)
AT1G64185 189 / 9e-64 Lactoylglutathione lyase / glyoxalase I family protein (.1)
AT1G07645 40 / 7e-05 ATDSI-1VOC dessication-induced 1VOC superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024719 236 / 2e-82 AT5G41650 196 / 2e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10025564 86 / 1e-20 AT5G46680 276 / 2e-88 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G135100 211 / 2e-72 AT5G41650 207 / 5e-71 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Potri.001G237500 44 / 1e-06 AT1G07645 215 / 3e-73 dessication-induced 1VOC superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10032333 pacid=23168482 polypeptide=Lus10032333 locus=Lus10032333.g ID=Lus10032333.BGIv1.0 annot-version=v1.0
ATGGCCTCGTTCAGGTGGATCCTGCAACTCCACAAGGATGTTCCCAAGGCGGCTCGTTTCTACTCCGAAGGGCTGGATTTCACCGTCAATGTATGCACCC
TACGATGGGCTGAACTTCATTCGGGGCCTCTGAAGCTCGCCCTCATGCAATCTACCGACGACAATGTTTCACAGAAGGGGCATTCTAATTTGCTATCATT
CACAGTCACTGACATCAACAGTACAGTGACAAAGCTAATGGCTTTAGGCGCTGAGCTAGATGGCCCCATCAAGTATGAAATTCATGGGAAGGTTGCAGCC
ATGCGTGGTATAGACGGCCACGTCTTAGGACTTTATGAACCAGCATAA
AA sequence
>Lus10032333 pacid=23168482 polypeptide=Lus10032333 locus=Lus10032333.g ID=Lus10032333.BGIv1.0 annot-version=v1.0
MASFRWILQLHKDVPKAARFYSEGLDFTVNVCTLRWAELHSGPLKLALMQSTDDNVSQKGHSNLLSFTVTDINSTVTKLMALGAELDGPIKYEIHGKVAA
MRGIDGHVLGLYEPA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G41650 Lactoylglutathione lyase / gly... Lus10032333 0 1
AT5G23050 AAE17 acyl-activating enzyme 17 (.1) Lus10038966 14.8 0.8909
AT2G04305 Magnesium transporter CorA-lik... Lus10020472 35.3 0.8414
AT2G17020 F-box/RNI-like superfamily pro... Lus10025093 39.9 0.8704
AT1G31970 STRS1 STRESS RESPONSE SUPPRESSOR 1, ... Lus10004552 42.5 0.8607
AT4G39910 ATUBP3 ubiquitin-specific protease 3 ... Lus10014333 61.5 0.8566
AT2G43370 RNA-binding (RRM/RBD/RNP motif... Lus10025557 62.4 0.8642
AT5G17840 DnaJ/Hsp40 cysteine-rich domai... Lus10001328 63.2 0.8419
AT2G02390 GST18, ATGSTZ1 GLUTATHIONE S-TRANSFERASE 18, ... Lus10030274 64.2 0.8558
AT5G51020 CAA33, CRL constitutive activator of AAA-... Lus10032529 74.3 0.8576
AT2G39740 HESO1 HEN1 suppressor 1, Nucleotidyl... Lus10001012 77.7 0.8534

Lus10032333 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.