Lus10032334 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07830 194 / 2e-64 ribosomal protein L29 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024720 233 / 2e-79 AT1G07830 206 / 8e-70 ribosomal protein L29 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G111100 209 / 2e-70 AT1G07830 216 / 2e-73 ribosomal protein L29 family protein (.1)
Potri.002G185800 194 / 2e-64 AT1G07830 203 / 3e-68 ribosomal protein L29 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0346 Ribo_L29 PF06984 MRP-L47 Mitochondrial 39-S ribosomal protein L47 (MRP-L47)
Representative CDS sequence
>Lus10032334 pacid=23168583 polypeptide=Lus10032334 locus=Lus10032334.g ID=Lus10032334.BGIv1.0 annot-version=v1.0
ATGATGAGATTTTTTGGGAGAAGCCTCCTTGCTTCTGCGAGATCTGAATCATCCACAGCAACAGCTGCTACATCAGGTAATCATGGACATAACCCTCTTG
AGCAGTTGAGATTTTTTGGGAGAAGCCTCCTTGCTTCTGCGAGATCTGAATCATCCACAGCAACAGCTGCTACATCAGCTAGTCTTGGACATAACCCTCT
TGAGCAGTTCTTTGAGATAGACAGGAGAGAAGATGATGAGAAGCCTGTAGTATATGGTCGAAGTTGGAAAGCCTCCGAACTGCGGTTGAAATCTTGGGAT
GATCTACAGAAGCTATGGTACGTCCTTATGAAGGAGAAGAACATGCTTATGACTCAACGCCAGATGCTTCATTCCCAGAACCTGAGATTTCCAAATCCAG
AGCGCTTGCCGAAAGTTAGGAAGTCAATGTGTCGCATCAAACAAGTGCTCACCGAGAGAGCAATCGAAGATCCGGATCCAAGGAGGTCTGCAGAGATGAA
GAGGATGGTAAATGCTTTGTAA
AA sequence
>Lus10032334 pacid=23168583 polypeptide=Lus10032334 locus=Lus10032334.g ID=Lus10032334.BGIv1.0 annot-version=v1.0
MMRFFGRSLLASARSESSTATAATSGNHGHNPLEQLRFFGRSLLASARSESSTATAATSASLGHNPLEQFFEIDRREDDEKPVVYGRSWKASELRLKSWD
DLQKLWYVLMKEKNMLMTQRQMLHSQNLRFPNPERLPKVRKSMCRIKQVLTERAIEDPDPRRSAEMKRMVNAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G07830 ribosomal protein L29 family p... Lus10032334 0 1
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Lus10027260 2.0 0.9626
AT4G14320 Zinc-binding ribosomal protein... Lus10010195 2.0 0.9614
AT2G46230 PIN domain-like family protein... Lus10010134 3.7 0.9403
AT1G34030 Ribosomal protein S13/S18 fami... Lus10014676 5.7 0.9478
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10014035 7.2 0.9442
AT1G36240 Ribosomal protein L7Ae/L30e/S1... Lus10019681 7.7 0.9310
AT5G27700 Ribosomal protein S21e (.1) Lus10015173 9.7 0.9441
AT1G41880 Ribosomal protein L35Ae family... Lus10028254 9.8 0.9398
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10000421 10.2 0.9279
AT4G18100 Ribosomal protein L32e (.1) Lus10020410 11.5 0.9441

Lus10032334 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.