Lus10032336 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G11591 76 / 2e-20 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024722 124 / 1e-39 AT3G11591 74 / 1e-19 unknown protein
Lus10016986 54 / 8e-12 AT3G11591 44 / 1e-07 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G207600 87 / 6e-25 AT3G11591 89 / 1e-25 unknown protein
Potri.008G011620 58 / 3e-13 AT3G11591 44 / 6e-08 unknown protein
PFAM info
Representative CDS sequence
>Lus10032336 pacid=23168577 polypeptide=Lus10032336 locus=Lus10032336.g ID=Lus10032336.BGIv1.0 annot-version=v1.0
ATGGCGATCTGGACGTACCCGCCGACGAGGAAGCAAGCGGCGGCGATGGTGCTTATGTTCGCGACCGGAGCTTCTCTGTTCAGCTACGGGGCCTACATGT
CTCTGAAGAACGTGGAACCTCAGCAAGAGCGTACAAGAGCTCGGAATGAATTTGTGAAAGAGCGGATCCGGAAGTTGATCGGAGAAGATTAG
AA sequence
>Lus10032336 pacid=23168577 polypeptide=Lus10032336 locus=Lus10032336.g ID=Lus10032336.BGIv1.0 annot-version=v1.0
MAIWTYPPTRKQAAAMVLMFATGASLFSYGAYMSLKNVEPQQERTRARNEFVKERIRKLIGED

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G11591 unknown protein Lus10032336 0 1
AT3G24000 Tetratricopeptide repeat (TPR)... Lus10002561 6.4 0.7097
AT3G49710 Pentatricopeptide repeat (PPR)... Lus10006743 10.4 0.7088
AT1G71730 unknown protein Lus10042772 20.5 0.6534
AT5G64350 FKP12, ATFKBP12... ARABIDOPSIS THALIANA FK506-BIN... Lus10016586 20.6 0.7011
AT3G02950 AtTHO7 Tho complex subunit 7/Mft1p (.... Lus10012882 21.5 0.6344
AT3G63390 unknown protein Lus10024829 21.9 0.6379
AT5G47630 MTACP3 mitochondrial acyl carrier pro... Lus10038782 34.5 0.6167
AT3G15395 unknown protein Lus10039067 39.1 0.6061
AT3G18030 ATHAL3A HALOTOLERANCE DETERMINANT 3, A... Lus10014795 44.9 0.5703
AT2G32520 alpha/beta-Hydrolases superfam... Lus10035287 47.1 0.6259

Lus10032336 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.