Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04550 102 / 9e-27 unknown protein AT5G28500 83 / 2e-19 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G044900 [exp] 120 / 4e-33 AT3G04550 421 / 6e-145 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032342 pacid=23168599 polypeptide=Lus10032342 locus=Lus10032342.g ID=Lus10032342.BGIv1.0 annot-version=v1.0 ATGAAGGATTTCCCTAGGTGGAAGGGTGAGAAAAATTGGGAGGATTTCGATTACGACCTTCCAGAGGATTGTTTATCGTTTCTTTACTTCCGGCAGGCGA GGGAGAATAAGAACCCGTCCGATCATAGAACCAGCGGGCTGAAAATGGCTCTGGAAGTAGCCGAACCGGAGAAGGCGAAAGCGGCGATGTTAGGAGAGAT AGAAAGAGGAGGAGGGAAGGAAGGAGAAGAAAGCGGGGGAAATGAAATTGACGCGAATAGGGTTCCAGTGGTGATGATAAAGATCGGGGAAGTCGAAGAG ACTTTTATAGTGAAGCTGCCAGAAATCCAGTTATATTACCCGCCGGTTTGCAGATCAGAGGATGAAACAGAGAGATGA
AA sequence Show only first row Show all	>Lus10032342 pacid=23168599 polypeptide=Lus10032342 locus=Lus10032342.g ID=Lus10032342.BGIv1.0 annot-version=v1.0 MKDFPRWKGEKNWEDFDYDLPEDCLSFLYFRQARENKNPSDHRTSGLKMALEVAEPEKAKAAMLGEIERGGGKEGEESGGNEIDANRVPVVMIKIGEVEE TFIVKLPEIQLYYPPVCRSEDETER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04550			unknown protein		Lus10032342 [exp]	0	1
AT1G13030			sphere organelles protein-rela...		Lus10006465 [exp]	12.3	0.7254
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10015076 [exp]	12.4	0.6914
AT3G14460			LRR and NB-ARC domains-contain...		Lus10040210 [exp]	25.2	0.5706
AT2G30280		RDM4, DMS4	DEFECTIVE IN MERISTEM SILENCIN...		Lus10036634 [exp]	30.2	0.6440
AT5G44620		CYP706A3	"cytochrome P450, family 706, ...		Lus10024575 [exp]	32.7	0.6232
AT3G49055			unknown protein		Lus10021563 [exp]	49.5	0.5827
AT4G02210			unknown protein		Lus10008312 [exp]	75.1	0.5940
					Lus10039737 [exp]	82.7	0.6091
					Lus10020703 [exp]	149.4	0.5516
					Lus10011620 [exp]	159.3	0.5509

Compare expression of checked genes

Lus10032342 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.