Lus10032346 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14190 223 / 1e-71 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
AT1G14185 220 / 1e-70 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
AT1G73050 160 / 2e-47 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
AT1G72970 155 / 2e-45 HTH, EDA17 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2)
AT1G12570 152 / 3e-44 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
AT3G56060 147 / 2e-42 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
AT5G51950 130 / 5e-36 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2)
AT5G51930 128 / 2e-35 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030463 259 / 1e-85 AT1G14185 504 / 5e-176 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Lus10032641 255 / 7e-84 AT1G14185 608 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Lus10030462 253 / 2e-83 AT1G14185 567 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Lus10026606 251 / 7e-83 AT1G14190 554 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Lus10030461 246 / 4e-80 AT1G14185 596 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Lus10030460 245 / 6e-80 AT1G14185 555 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Lus10030459 244 / 2e-79 AT1G14185 605 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Lus10030458 239 / 5e-78 AT1G14185 481 / 5e-167 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Lus10030456 239 / 2e-77 AT1G14185 634 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G087400 225 / 3e-72 AT1G14185 639 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Potri.010G168100 223 / 2e-71 AT1G14185 654 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Potri.010G168200 220 / 3e-70 AT1G14190 598 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Potri.001G111500 156 / 9e-46 AT1G12570 773 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Potri.003G039000 156 / 1e-45 AT1G72970 808 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2)
Potri.008G009600 155 / 1e-45 AT1G73050 785 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Potri.001G200800 155 / 4e-45 AT1G72970 831 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2)
Potri.012G135200 149 / 1e-43 AT5G51950 525 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF00732 GMC_oxred_N GMC oxidoreductase
Representative CDS sequence
>Lus10032346 pacid=23168557 polypeptide=Lus10032346 locus=Lus10032346.g ID=Lus10032346.BGIv1.0 annot-version=v1.0
ATGACTTCAAATCTGGACGATGTAGCAGGGAAGTCCTTTGACTACATTGTAGTAGGCGGAGGGACAGCCGGTTGCCCTATTGCAGCTACCCTGTCGGAGA
AATTCTCCGTTCTACTAATCGAGCGCGGTGGCTCCCCATATGGGGACCCGTGGATAACAGAGAAGCGCTTCCTTGGCTTCTCATTGCTCCAAACTGATGA
ATTCTCATCGATCTCCCAATCATTCACTTCCAAGGAAGGAGTAGCAAACTTCAGAGGAAGAGTCCTTGGAGGGACGACAGCTATAAATGGAGGGTTCTAC
AGTCGAGCCAGCGAGGAATTCGTCACGAAATCGGGTTGGGATAAACAGCTGGTGAAGGAATCTTACGAATGGGTTGAATCTAAAATCATTACTAAACCTG
AGCTGACAACGTGGCAAGCCGCTGTCAGGGCTGGATAA
AA sequence
>Lus10032346 pacid=23168557 polypeptide=Lus10032346 locus=Lus10032346.g ID=Lus10032346.BGIv1.0 annot-version=v1.0
MTSNLDDVAGKSFDYIVVGGGTAGCPIAATLSEKFSVLLIERGGSPYGDPWITEKRFLGFSLLQTDEFSSISQSFTSKEGVANFRGRVLGGTTAINGGFY
SRASEEFVTKSGWDKQLVKESYEWVESKIITKPELTTWQAAVRAG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14190 Glucose-methanol-choline (GMC)... Lus10032346 0 1
AT1G14185 Glucose-methanol-choline (GMC)... Lus10032347 2.2 0.9624
AT5G46970 Plant invertase/pectin methyle... Lus10019498 2.4 0.9523
AT2G26710 CYP72B1, CYP734... PHYB ACTIVATION TAGGED SUPPRES... Lus10036942 4.5 0.9399
AT4G37980 ELI3-1, ATCAD7 CINNAMYL-ALCOHOL DEHYDROGENASE... Lus10023268 6.2 0.9496
AT5G52790 CBS domain-containing protein ... Lus10039289 9.8 0.8844
AT1G61110 NAC ANAC025 NAC domain containing protein ... Lus10019926 9.9 0.9278
AT1G67030 C2H2ZnF ZFP6 zinc finger protein 6 (.1) Lus10017609 10.6 0.9276
AT2G36890 MYB BIT1, ATMYB38, ... REGULATOR OF AXILLARY MERISTEM... Lus10023002 10.7 0.9374
AT5G45290 RING/U-box superfamily protein... Lus10016428 11.2 0.9388
AT4G10310 ATHKT1, HKT1 high-affinity K+ transporter 1... Lus10030616 12.3 0.9057

Lus10032346 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.