Lus10032352 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53300 302 / 2e-107 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT4G27960 301 / 5e-107 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT1G64230 298 / 6e-106 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT3G08690 296 / 3e-105 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G41700 296 / 6e-105 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT5G56150 280 / 1e-98 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT2G16740 276 / 2e-97 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08700 251 / 3e-87 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 164 / 1e-52 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G16890 152 / 6e-48 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033937 305 / 1e-108 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10014942 303 / 1e-107 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 303 / 1e-107 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 303 / 1e-107 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 303 / 1e-107 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10022726 295 / 9e-105 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014187 295 / 9e-105 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10021385 292 / 1e-103 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027846 288 / 7e-102 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G033000 306 / 5e-109 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 306 / 5e-109 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.001G094900 304 / 3e-108 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.003G136200 302 / 2e-107 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 300 / 8e-107 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.006G110200 300 / 1e-106 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.016G138900 298 / 5e-106 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G471200 293 / 1e-103 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.011G168200 291 / 2e-103 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.004G175000 290 / 2e-102 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10032352 pacid=23168511 polypeptide=Lus10032352 locus=Lus10032352.g ID=Lus10032352.BGIv1.0 annot-version=v1.0
ATGGCTTCCAAGCGGATCTTGAAGGAGCTCAAGGATCTCCAGAAAGACCCTCCTACCTCTTGCAGCGCAGGTCCTGTCGCTGAAGACATGTTCCATTGGC
AAGCAACGATTATGGGCCCTCCTGATAGCCCATATGCCGGTGGAGTGTTTCTAGTCAGTATTCACTTCCCACCAGACTATCCATTCAAGCCACCAAAGGT
TGCTTTCAGGACAAAGGTATTCCACCCCAATATCAACAGCAACGGTAGCATCTGCCTGGATATTCTCAAAGAGCAGTGGAGCCCGGCTTTAACCATCTCG
AAGGTGTTGCTGTCCATTTGCTCCCTGTTGACGGACCCCAACCCCGACGACCCATTGGTCCCGGAGATTGCCCACATGTACAAGACCGATAAGAACAAGT
ACGAAACAACTGCGAGGAGCTGGACTCAGAAGTACGCCATGGGTTAA
AA sequence
>Lus10032352 pacid=23168511 polypeptide=Lus10032352 locus=Lus10032352.g ID=Lus10032352.BGIv1.0 annot-version=v1.0
MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTIS
KVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYETTARSWTQKYAMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53300 UBC10 ubiquitin-conjugating enzyme 1... Lus10032352 0 1
AT5G53300 UBC10 ubiquitin-conjugating enzyme 1... Lus10033937 1.0 0.8913
AT2G37380 MAKR3 MEMBRANE-ASSOCIATED KINASE REG... Lus10024441 4.1 0.8314
AT3G08910 DNAJ heat shock family protein... Lus10005033 4.6 0.8642
AT5G43060 Granulin repeat cysteine prote... Lus10014087 6.3 0.8793
AT5G63480 unknown protein Lus10037639 7.3 0.7972
AT1G03910 unknown protein Lus10027605 10.6 0.8367
AT5G18110 NCBP novel cap-binding protein (.1) Lus10005704 11.1 0.8597
AT1G61730 GeBP DNA-binding storekeeper protei... Lus10010076 13.9 0.8447
AT3G08910 DNAJ heat shock family protein... Lus10027803 14.1 0.8592
AT5G37930 Protein with RING/U-box and TR... Lus10028535 17.3 0.7858

Lus10032352 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.