Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23760 66 / 7e-15 Cox19-like CHCH family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G136500 [exp] 68 / 2e-16 AT4G23760 89 / 8e-25 Cox19-like CHCH family protein (.1) Potri.001G094750 [exp] 61 / 7e-14 AT4G23760 63 / 9e-15 Cox19-like CHCH family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [flax] [poplar] CHCH PF06747 [flax] [poplar] CHCH CHCH domain
Representative CDS sequence Show only first row Show all	>Lus10032354 pacid=23168652 polypeptide=Lus10032354 locus=Lus10032354.g ID=Lus10032354.BGIv1.0 annot-version=v1.0 ATGGAGAAGGCGGTAGCTGTGTGCGGAAAAGAAGCGCTGGATCTGCTCAACTGCGTCGCTCAGTCGCCCTACGATCAGGACAAATGCGTCCGTCTCTTGC AGGCTTTGCGAGAGTGTGTCGACAGGAAGTACAAGCGAGCAACCTGTAGCGCAAAGGAGAAGCTTATTGCATTATGCCTTGTTGATGGCTTTGTTTCGTT AGATATGATAATGCTTCATCGTGCATTCTCTGATTCTGAATCGGCATTGTTCGTTTCTCCGCAGAATGTGAAGAATTTCTCGCTAGCAAATGAGGGCAAG GAAGAGGCAACTCCGAAGAAAGGTTGA
AA sequence Show only first row Show all	>Lus10032354 pacid=23168652 polypeptide=Lus10032354 locus=Lus10032354.g ID=Lus10032354.BGIv1.0 annot-version=v1.0 MEKAVAVCGKEALDLLNCVAQSPYDQDKCVRLLQALRECVDRKYKRATCSAKEKLIALCLVDGFVSLDMIMLHRAFSDSESALFVSPQNVKNFSLANEGK EEATPKKG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23760			Cox19-like CHCH family protein...		Lus10032354 [exp]	0	1
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Lus10015667 [exp]	14.5	0.8732
AT2G37470			Histone superfamily protein (....		Lus10023753 [exp]	16.0	0.8730
AT4G17550		AtG3Pp4	glycerol-3-phosphate permease ...		Lus10004358 [exp]	18.8	0.8486
AT1G73160			UDP-Glycosyltransferase superf...		Lus10014499 [exp]	19.6	0.8663
AT1G43710		EMB1075	embryo defective 1075, Pyridox...		Lus10028592 [exp]	21.8	0.8760
AT4G31420	C2H2ZnF		Zinc finger protein 622 (.1.2)		Lus10020150 [exp]	34.5	0.8660
AT3G63500			Protein of unknown function (D...		Lus10019718 [exp]	36.2	0.8586
AT1G11320			unknown protein		Lus10013574 [exp]	38.5	0.8708
AT3G12130	C3HZnF		KH domain-containing protein /...		Lus10012017 [exp]	38.7	0.8615
AT2G43040		NPG1	no pollen germination 1, tetra...		Lus10020725 [exp]	43.2	0.8612

Compare expression of checked genes

Lus10032354 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.