Lus10032363 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G13600 164 / 1e-47 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G39350 163 / 2e-47 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G33990 162 / 1e-46 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G20230 161 / 2e-46 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G40410 158 / 5e-46 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G11460 153 / 5e-44 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G46790 153 / 5e-44 CRR2 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G13410 150 / 8e-44 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G66520 152 / 9e-44 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G18750 150 / 2e-42 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033946 309 / 3e-103 AT4G18750 410 / 1e-132 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10018265 152 / 5e-47 AT5G16860 192 / 1e-57 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10018223 159 / 1e-45 AT2G29760 931 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031989 156 / 9e-45 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000706 155 / 2e-44 AT3G12770 878 / 0.0 mitochondrial editing factor 22 (.1)
Lus10037362 154 / 4e-44 AT3G57430 477 / 9e-158 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10007806 155 / 5e-44 AT3G03580 967 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040680 154 / 5e-44 AT2G29760 926 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016387 151 / 5e-44 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G369900 166 / 9e-49 AT5G66520 512 / 2e-175 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G053600 163 / 1e-47 AT3G04750 759 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G065500 162 / 2e-47 AT5G06540 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G237000 162 / 3e-47 AT5G66520 544 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.007G104700 159 / 8e-46 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.008G121400 157 / 9e-46 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G124400 157 / 2e-45 AT5G39350 785 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G044700 157 / 5e-45 AT3G22690 582 / 0.0 unknown protein
Potri.013G103600 155 / 6e-45 AT1G08070 477 / 7e-160 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G058900 156 / 1e-44 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10032363 pacid=23168541 polypeptide=Lus10032363 locus=Lus10032363.g ID=Lus10032363.BGIv1.0 annot-version=v1.0
ATGCACGGGCATGGCCAGGCAGCATTGAAGCTTCTACAGGAGATGAACTGGTTAGGAATCAATCCCGATTCTGTTATGTTCACTTCTGTTCTATCTGGGT
GTGACCATTCTGGTCTTGTGGAAGAGGGTCTTAAGCTCTTTGAGAGCATGACAAGAGAATATGGATTCATTCCCAGGATGGAACATTATTCTTGCGTTGT
TAACATGCTGGCACGTGCCAGTAGGTTAGAAGCTGCTACATCTTTCATTCATCAGATGCCATTACAGCCTGATAAGTCTATCTGGGGAGGCTTACTGGCG
GCTTGCCTTGAACAACAAAACGTTGACGTTGGGAAGCTGGCGGCTGAACAGTTGGTCCATCTCGAACCTCGGTGTTCTGGACATTATGTCACTTCGGCTA
ACTTGTACGCTGAAGCTGGCAATTGGTGTGATGCAGTAAGGGTGAGAAAGGAAATGGAAGTTAGAGGGTTGGTTAAGACGTCTGGGCAGAATGGATAA
AA sequence
>Lus10032363 pacid=23168541 polypeptide=Lus10032363 locus=Lus10032363.g ID=Lus10032363.BGIv1.0 annot-version=v1.0
MHGHGQAALKLLQEMNWLGINPDSVMFTSVLSGCDHSGLVEEGLKLFESMTREYGFIPRMEHYSCVVNMLARASRLEAATSFIHQMPLQPDKSIWGGLLA
ACLEQQNVDVGKLAAEQLVHLEPRCSGHYVTSANLYAEAGNWCDAVRVRKEMEVRGLVKTSGQNG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G13600 Pentatricopeptide repeat (PPR)... Lus10032363 0 1
AT2G40190 LEW3 LEAF WILTING 3, UDP-Glycosyltr... Lus10008975 13.2 0.7226
Lus10017572 13.7 0.7515
AT1G53710 Calcineurin-like metallo-phosp... Lus10042936 16.9 0.7402
AT3G25840 Protein kinase superfamily pro... Lus10035032 19.5 0.7482
AT1G67490 KNOPF, KNF, GCS... KNOPF, glucosidase 1 (.1.2) Lus10037009 19.5 0.7054
AT5G48840 ATPTS, PANC ARABIDOPSIS THALIANA PANTOTHEN... Lus10025932 20.3 0.7337
AT1G47570 RING/U-box superfamily protein... Lus10033472 35.9 0.7324
AT2G17020 F-box/RNI-like superfamily pro... Lus10022652 36.7 0.7276
AT2G24990 Serine/threonine-protein kinas... Lus10032627 38.8 0.7210
AT1G09730 Cysteine proteinases superfami... Lus10000917 39.6 0.7162

Lus10032363 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.