Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G24975 39 / 0.0001 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023085 [exp] 110 / 1e-32 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) Lus10002747 [exp] 77 / 2e-19 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10023195 [exp] 69 / 2e-16 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) Lus10016329 [exp] 69 / 3e-16 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10019767 [exp] 69 / 6e-16 AT4G29035 50 / 1e-08 Plant self-incompatibility protein S1 family (.1) Lus10018785 [exp] 69 / 6e-16 AT4G16295 50 / 1e-08 S-protein homologue 1 (.1) Lus10002219 [exp] 65 / 5e-15 AT1G04645 40 / 2e-05 Plant self-incompatibility protein S1 family (.1) Lus10023196 [exp] 64 / 5e-14 AT2G06090 54 / 4e-10 Plant self-incompatibility protein S1 family (.1) Lus10019768 [exp] 61 / 6e-13 AT4G16195 50 / 2e-08 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G008300 [exp] 48 / 5e-08 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 42 / 2e-05 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.016G066900 [exp] 39 / 0.0002 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 37 / 0.0007 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10032383 pacid=23168479 polypeptide=Lus10032383 locus=Lus10032383.g ID=Lus10032383.BGIv1.0 annot-version=v1.0 ATGGCTGCAGCAGCAGGTCCGTCGTCGTCGTCGTCGCAGTTAGTGGAGGTAATGATTACTAACAAGCTAAGTAAATCGGTGATTGCTCATTGTCAGTCCA AAGACTACGATTTACGCGCCTTAGTCGTTCTTCCCGGCGCTAATTTGAAATGGAGGTTCGATCTGGAGTGGAGTATAACAATCTTCTGGTGTGATCTCGC CGTAGACGAGAGGCGTCTCCATTTCGACGCCTCCACCGAGCAGAGACATCGCCCGCCCATCTGGGATATCAACGACGGTGGGGTTTCTTTCAGTGACGAC ATTTTTCTTATGTTTCCATGGACCTAA
AA sequence Show only first row Show all	>Lus10032383 pacid=23168479 polypeptide=Lus10032383 locus=Lus10032383.g ID=Lus10032383.BGIv1.0 annot-version=v1.0 MAAAAGPSSSSSQLVEVMITNKLSKSVIAHCQSKDYDLRALVVLPGANLKWRFDLEWSITIFWCDLAVDERRLHFDASTEQRHRPPIWDINDGGVSFSDD IFLMFPWT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G24975			Plant self-incompatibility pro...		Lus10032383 [exp]	0	1
					Lus10011061 [exp]	2.4	1.0000
					Lus10009800 [exp]	4.5	1.0000
AT3G07740		HXA2, HXA02, HA...	homolog of yeast ADA2 2A (.1.2...		Lus10012337 [exp]	6.5	1.0000
					Lus10011496 [exp]	6.7	1.0000
					Lus10011848 [exp]	7.7	1.0000
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10011845 [exp]	8.1	1.0000
AT5G46795		MSP2	microspore-specific promoter ...		Lus10004566 [exp]	8.5	1.0000
AT4G10020		ATHSD5	hydroxysteroid dehydrogenase 5...		Lus10001280 [exp]	8.9	1.0000
					Lus10011759 [exp]	9.4	1.0000
AT1G12570			Glucose-methanol-choline (GMC)...		Lus10002957 [exp]	9.5	1.0000

Compare expression of checked genes

Lus10032383 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.