Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19835 72 / 6e-16 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) AT1G47900 60 / 9e-12 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012431 [exp] 160 / 5e-47 AT1G19835 901 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Lus10024325 [exp] 156 / 1e-45 AT1G19835 787 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Lus10024324 [exp] 155 / 2e-45 AT1G19835 919 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Lus10034510 [exp] 123 / 1e-34 AT1G19835 343 / 5e-108 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Lus10033160 [exp] 123 / 5e-34 AT1G19835 949 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Lus10033813 [exp] 69 / 6e-17 AT1G19835 57 / 1e-11 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G024400 [exp] 100 / 3e-26 AT1G19835 941 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Potri.005G237100 [exp] 93 / 1e-23 AT1G19835 869 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032386 pacid=23168659 polypeptide=Lus10032386 locus=Lus10032386.g ID=Lus10032386.BGIv1.0 annot-version=v1.0 ATGGCAGTTGATGATGCTTTGGACTGCAATGGTTTGACCAAGAAAATAGATGAGCTCTCTGTTACTATTAACAAAATTCTGAGCCAAGGTACAAGCTTGA CTACGTTCGTTTTCGACCTTTCTCATGTAATGGATAAAGCAAGTGAACTCCGGTTCAGTGTCCTTGGGTACAAATGTAATGAAGAGGAAATCAACATCCC AGATTGTATAGATAAAGTTGCCTTACCAGAGAACAAGATTGTACAACAGGATGATGGTCCGTCGTCATCGTCATCTGGCGTGAGTTACGAGAATGGCTAG
AA sequence Show only first row Show all	>Lus10032386 pacid=23168659 polypeptide=Lus10032386 locus=Lus10032386.g ID=Lus10032386.BGIv1.0 annot-version=v1.0 MAVDDALDCNGLTKKIDELSVTINKILSQGTSLTTFVFDLSHVMDKASELRFSVLGYKCNEEEINIPDCIDKVALPENKIVQQDDGPSSSSSGVSYENG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G19835			Plant protein of unknown funct...		Lus10032386 [exp]	0	1
AT2G43020		ATPAO2	polyamine oxidase 2 (.1)		Lus10001044 [exp]	1.0	0.8588
					Lus10021578 [exp]	1.4	0.8586
AT2G30690			Protein of unknown function, D...		Lus10014743 [exp]	2.4	0.8254
AT3G12620			Protein phosphatase 2C family ...		Lus10023470 [exp]	4.5	0.8260
AT5G55180			O-Glycosyl hydrolases family 1...		Lus10029149 [exp]	5.3	0.8084
AT5G39785			Protein of unknown function (D...		Lus10007264 [exp]	5.7	0.8325
AT4G18490			unknown protein		Lus10021779 [exp]	7.3	0.8387
AT4G21760		BGLU47	beta-glucosidase 47 (.1)		Lus10043093 [exp]	7.9	0.7769
AT5G17680			disease resistance protein (TI...		Lus10043227 [exp]	13.0	0.8203
AT1G76970			Target of Myb protein 1 (.1)		Lus10017220 [exp]	14.1	0.7868

Compare expression of checked genes

Lus10032386 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.