Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42060 57 / 4e-12 DEK, chromatin associated protein (.1) AT4G00980 45 / 7e-07 zinc knuckle (CCHC-type) family protein (.1) AT1G64490 43 / 2e-06 DEK, chromatin associated protein (.1) AT4G10920 42 / 9e-06 KELP transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032410 [exp] 46 / 2e-07 AT4G10920 169 / 2e-54 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2) Lus10023061 [exp] 45 / 9e-07 AT4G10920 132 / 7e-40 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G089400 [exp] 43 / 3e-06 AT4G10920 152 / 5e-48 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08766 [flax] [poplar] DEK_C DEK C terminal domain
Representative CDS sequence Show only first row Show all	>Lus10032409 pacid=23168477 polypeptide=Lus10032409 locus=Lus10032409.g ID=Lus10032409.BGIv1.0 annot-version=v1.0 ATGGCGGCGCCGGAGCTCTCGGAAGAGGAGCAGCTGGAGGAGTTGTCGGCAGGGACGGAGAAGAAGATAGTGAAGCGAGTGAGGAAGATACTGGAGAAGG AGAATCTGTACCAGCTCTCGGAGAGGCAAATCCGGGACAAAGCGTCGGAAAAGCTCGGAATCGACCTATCGGAGGAGCCGTACAAGTCGGTGGTCAGGAG AACGGTCGAAGATTTCCTGATGAAAATCATTAGCCAAGGAATACACCCCGGCGTCCAATCTCGGCTTAAGTAA
AA sequence Show only first row Show all	>Lus10032409 pacid=23168477 polypeptide=Lus10032409 locus=Lus10032409.g ID=Lus10032409.BGIv1.0 annot-version=v1.0 MAAPELSEEEQLEELSAGTEKKIVKRVRKILEKENLYQLSERQIRDKASEKLGIDLSEEPYKSVVRRTVEDFLMKIISQGIHPGVQSRLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42060			DEK, chromatin associated prot...		Lus10032409 [exp]	0	1
AT3G57560		NAGK	N-acetyl-l-glutamate kinase (....		Lus10030601 [exp]	1.7	0.9221
AT2G43090			Aconitase/3-isopropylmalate de...		Lus10007488 [exp]	3.0	0.8925
AT5G09570			Cox19-like CHCH family protein...		Lus10007086 [exp]	5.7	0.8742
AT2G20940			Protein of unknown function (D...		Lus10025069 [exp]	6.9	0.8819
AT3G43520			Transmembrane proteins 14C (.1...		Lus10027640 [exp]	8.0	0.8951
AT4G26810			SWIB/MDM2 domain superfamily p...		Lus10038799 [exp]	8.9	0.8534
AT2G04160		AIR3	AUXIN-INDUCED IN ROOT CULTURES...		Lus10014591 [exp]	9.4	0.8874
AT1G77670			Pyridoxal phosphate (PLP)-depe...		Lus10004089 [exp]	11.2	0.8759
AT3G22530			unknown protein		Lus10010549 [exp]	13.7	0.8430
AT5G50960		ATNBP35, NBP35	nucleotide binding protein 35 ...		Lus10027463 [exp]	15.0	0.8424

Compare expression of checked genes

Lus10032409 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.