Lus10032419 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64510 232 / 1e-77 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023054 392 / 3e-140 AT1G64510 234 / 2e-78 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G088300 248 / 8e-84 AT1G64510 263 / 3e-90 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01250 Ribosomal_S6 Ribosomal protein S6
Representative CDS sequence
>Lus10032419 pacid=23168676 polypeptide=Lus10032419 locus=Lus10032419.g ID=Lus10032419.BGIv1.0 annot-version=v1.0
ATGGCGTCCTCAGCAGTTTCGTCTACTCTATTCTACTCCCCAATTTTCTCCAAATCTCTCTCGAAGTCCAACCCGTCACCGTCTTCAGCATTTTTCCGGC
GGTTTAATGCTAATGCGACGGAAATTGTCCACCGTGTAAGAGACCGCGAAGGCGTGGTGAAGGCACAGACATTCGATTTCTCTGGTTCGTTCTATGGAGG
GAGGTTTGCCTCCGACGACGACGACGATGACGACCAGGAACCTCCGATGGAGGGCACCCTGTTGGAAATGGAGGAGAGAGAGACCCCTCCTTGCCCGCCT
GGGCTGCGGCAGTACGAGACCATGGCTGTGTTGAGGCCGGACATGTCTGAAGATGAACGGCTTGCTCTTACTCAGAAGTACGAAGAGTTGCTTGTAGCTG
GGGGTGGGATGTATGTGGAGGCATTCAACAGAGGAGTGCTTCCACTATCCTACAGCATCAAGAAGAAGAACAAAGCTGGTGAAACCAACACCTATATGGA
TGGGATCTACCTCCTCTTCACTTACTTCACAAAACCAGAATCCTTGAACGCCCTCGAAACAACGATGAATACCGACGATGACGTGATCCGACACAGCACT
TTCAAAATCAGGAAGAGGAAGATAGATCTTCCCTATGAATCCGATGAATACGCTACTGAGGTAGAGGCTGGACTATGA
AA sequence
>Lus10032419 pacid=23168676 polypeptide=Lus10032419 locus=Lus10032419.g ID=Lus10032419.BGIv1.0 annot-version=v1.0
MASSAVSSTLFYSPIFSKSLSKSNPSPSSAFFRRFNANATEIVHRVRDREGVVKAQTFDFSGSFYGGRFASDDDDDDDQEPPMEGTLLEMEERETPPCPP
GLRQYETMAVLRPDMSEDERLALTQKYEELLVAGGGMYVEAFNRGVLPLSYSIKKKNKAGETNTYMDGIYLLFTYFTKPESLNALETTMNTDDDVIRHST
FKIRKRKIDLPYESDEYATEVEAGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64510 Translation elongation factor... Lus10032419 0 1
AT2G33800 EMB3113 EMBRYO DEFECTIVE 3113, Ribosom... Lus10025445 1.7 0.9725
AT2G24090 Ribosomal protein L35 (.1) Lus10007706 2.0 0.9659
AT1G64510 Translation elongation factor... Lus10023054 2.0 0.9733
AT1G29070 Ribosomal protein L34 (.1) Lus10013928 2.2 0.9772
AT5G39530 Protein of unknown function (D... Lus10024051 5.5 0.9633
AT1G07320 EMB2784, RPL4 EMBRYO DEFECTIVE 2784, ribosom... Lus10040693 5.9 0.9625
AT4G25080 CHLM magnesium-protoporphyrin IX me... Lus10016728 7.5 0.9522
AT1G01080 RNA-binding (RRM/RBD/RNP motif... Lus10030194 8.7 0.9456
AT4G01310 Ribosomal L5P family protein (... Lus10007915 9.5 0.9510
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Lus10027894 11.2 0.9563

Lus10032419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.