Lus10032428 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G26975 79 / 2e-19 Ctr copper transporter family (.1)
AT5G59030 77 / 2e-18 COPT1 copper transporter 1 (.1)
AT5G59040 73 / 7e-17 COPT3 copper transporter 3 (.1)
AT3G46900 72 / 9e-17 COPT2 copper transporter 2 (.1)
AT2G37925 68 / 5e-15 COPT4 copper transporter 4 (.1)
AT5G20650 46 / 9e-07 COPT5 copper transporter 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023045 209 / 2e-70 AT2G26975 84 / 2e-21 Ctr copper transporter family (.1)
Lus10021107 112 / 2e-32 AT5G59040 87 / 1e-22 copper transporter 3 (.1)
Lus10017205 109 / 2e-31 AT2G26975 87 / 2e-22 Ctr copper transporter family (.1)
Lus10016464 82 / 5e-20 AT5G59030 151 / 1e-47 copper transporter 1 (.1)
Lus10040726 81 / 5e-20 AT2G26975 138 / 2e-42 Ctr copper transporter family (.1)
Lus10021108 73 / 8e-17 AT2G37925 120 / 2e-35 copper transporter 4 (.1)
Lus10016462 49 / 2e-08 AT5G59030 76 / 3e-19 copper transporter 1 (.1)
Lus10017204 48 / 7e-08 AT5G59030 88 / 3e-23 copper transporter 1 (.1)
Lus10007092 46 / 1e-06 AT5G20650 169 / 6e-55 copper transporter 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G093200 109 / 3e-31 AT3G46900 89 / 6e-23 copper transporter 2 (.1)
Potri.009G038700 84 / 4e-21 AT2G26975 133 / 2e-40 Ctr copper transporter family (.1)
Potri.006G093300 78 / 7e-19 AT2G37925 114 / 3e-33 copper transporter 4 (.1)
Potri.009G038800 71 / 5e-16 AT5G59030 148 / 4e-46 copper transporter 1 (.1)
Potri.001G246000 66 / 4e-14 AT5G59030 134 / 9e-41 copper transporter 1 (.1)
Potri.006G140700 44 / 4e-06 AT5G20650 151 / 7e-48 copper transporter 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04145 Ctr Ctr copper transporter family
Representative CDS sequence
>Lus10032428 pacid=23168602 polypeptide=Lus10032428 locus=Lus10032428.g ID=Lus10032428.BGIv1.0 annot-version=v1.0
ATGCCGATGGGACCAGGGACAATGTCTCCCGGCGGCGGAGACAACAACATGAACATGAACATGAGCATGGACAACAACATGAACATGATGCACAGCAGCT
TGTTCTGGGGGAAAGACGCAATCGTCCTCTTCTCCGGATGGCCCAACCACAGCCTACCCATGTACATATTCTCCTGCTTCGTCGTCTTTTCCATGGCCGC
TTCACTCGAGCTACTCATCATCCTTAAGCTTCCCACCCGCCCCGTTGTTGAGGCGGGTGTATATGCCCTGAGGATGGGCGTTGCTTACTTGCTCACGCTA
TCCGTCATGTCCTTCAATATCGGCATCTTTTTGGCTGCTGTGATCGGCCATTCTGTCGGGATGTTTGTCGCCAAGGTTCGTGCTTATCGTGCGGATGTGA
TTGTCGACGGCCGCCGGATGCCTGACGGAGATGCCAAGATTTGA
AA sequence
>Lus10032428 pacid=23168602 polypeptide=Lus10032428 locus=Lus10032428.g ID=Lus10032428.BGIv1.0 annot-version=v1.0
MPMGPGTMSPGGGDNNMNMNMSMDNNMNMMHSSLFWGKDAIVLFSGWPNHSLPMYIFSCFVVFSMAASLELLIILKLPTRPVVEAGVYALRMGVAYLLTL
SVMSFNIGIFLAAVIGHSVGMFVAKVRAYRADVIVDGRRMPDGDAKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G26975 Ctr copper transporter family ... Lus10032428 0 1

Lus10032428 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.