Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023044 [exp] 100 / 1e-27 AT5G18880 44 / 4e-05 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1) Lus10017305 [exp] 35 / 0.0007 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032429 pacid=23168544 polypeptide=Lus10032429 locus=Lus10032429.g ID=Lus10032429.BGIv1.0 annot-version=v1.0 ATGGAAATGGCAACTCACACAAAGCTCTTTGCACTTACTCTCATCATCTGCTTGCTCCTTGTGGATCTATCCGCCCCATCATCAAGTTTCCATGGCTCTG AAGCTGCCGAGAACCCTGTGAATCAGGCGGAGGTGTGGGGGAGGAATCTGGAGATGGAGATGGACTATGAGAAAGATCCAGGGGCTAATAACAAGCACTT GCCGCCATCAAACACCGCCAGCGTCCCTCCTCCTGGGGTTGGCGTCTGA
AA sequence Show only first row Show all	>Lus10032429 pacid=23168544 polypeptide=Lus10032429 locus=Lus10032429.g ID=Lus10032429.BGIv1.0 annot-version=v1.0 MEMATHTKLFALTLIICLLLVDLSAPSSSFHGSEAAENPVNQAEVWGRNLEMEMDYEKDPGANNKHLPPSNTASVPPPGVGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032429 [exp]	0	1
AT3G54900		ATGRXCP, CXIP1	GLUTAREDOXIN, CAX interacting ...		Lus10041501 [exp]	3.2	0.7727
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Lus10005443 [exp]	7.7	0.7645
AT5G24600			Protein of unknown function, D...		Lus10015590 [exp]	11.0	0.7573
AT1G12340			Cornichon family protein (.1)		Lus10004023 [exp]	12.4	0.7543
					Lus10034269 [exp]	14.7	0.7328
AT3G45400			exostosin family protein (.1)		Lus10005684 [exp]	18.1	0.7665
AT3G52080		CHX28	cation/hydrogen exchanger 28 (...		Lus10016403 [exp]	31.3	0.6661
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Lus10003302 [exp]	34.6	0.6603
AT5G65280		GCL1	GCR2-like 1 (.1)		Lus10025736 [exp]	36.7	0.7158
AT3G18590		AtENODL5	early nodulin-like protein 5 (...		Lus10022318 [exp]	37.1	0.7292

Compare expression of checked genes

Lus10032429 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.