Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51740 84 / 1e-20 Peptidase family M48 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038897 [exp] 89 / 3e-22 AT5G51740 501 / 1e-176 Peptidase family M48 family protein (.1) Lus10015019 [exp] 89 / 3e-22 AT5G51740 498 / 4e-175 Peptidase family M48 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G131100 [exp] 83 / 2e-20 AT5G51740 565 / 0.0 Peptidase family M48 family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032437 pacid=23168598 polypeptide=Lus10032437 locus=Lus10032437.g ID=Lus10032437.BGIv1.0 annot-version=v1.0 ATGGAACTGGAACTGGAACTGGAAGCTGACTACATTGACCTGCTATTGATGGCCTCAGCTGCATACGATCCTCGGGTGGCCCCGGCAGTGTACGGGGCAC TGAGGAACAAAATCAACTATATCCCGACCCATCCATCTAGGAAGAAGAGGTATCGATTGCTAGCTCGAGCTCATGTCATGGAAGAAGCACTCGCTCTGTA TAACGCAACTATGGCCAGACGTGAAACTAAAGGCTTCACTGAATGA
AA sequence Show only first row Show all	>Lus10032437 pacid=23168598 polypeptide=Lus10032437 locus=Lus10032437.g ID=Lus10032437.BGIv1.0 annot-version=v1.0 MELELELEADYIDLLLMASAAYDPRVAPAVYGALRNKINYIPTHPSRKKRYRLLARAHVMEEALALYNATMARRETKGFTE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51740			Peptidase family M48 family pr...		Lus10032437 [exp]	0	1
AT5G22460			alpha/beta-Hydrolases superfam...		Lus10004882 [exp]	2.0	1.0000
AT1G66950		ABCG39, PDR11, ...	ATP-binding cassette G39, plei...		Lus10006277 [exp]	2.8	1.0000
AT4G33920			Protein phosphatase 2C family ...		Lus10000700 [exp]	3.5	1.0000
AT2G29670			Tetratricopeptide repeat (TPR)...		Lus10025981 [exp]	4.0	1.0000
AT1G35670		CPK11, ATCDPK2,...	calcium-dependent protein kina...		Lus10017911 [exp]	4.9	1.0000
AT1G69940		ATPPME1	Pectin lyase-like superfamily ...		Lus10016711 [exp]	5.0	1.0000
AT4G20060		EMB1895	EMBRYO DEFECTIVE 1895, ARM rep...		Lus10038371 [exp]	5.9	1.0000
AT2G37360		ABCG2	ATP-binding cassette G2, ABC-2...		Lus10039859 [exp]	6.0	1.0000
AT5G58850	MYB	ATMYB119	myb domain protein 119 (.1)		Lus10040684 [exp]	6.3	1.0000
AT3G06920			Tetratricopeptide repeat (TPR)...		Lus10038657 [exp]	6.3	1.0000

Compare expression of checked genes

Lus10032437 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.