Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71050 175 / 2e-56 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 170 / 1e-54 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 157 / 1e-49 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT5G66110 150 / 1e-46 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 148 / 5e-46 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT4G39700 139 / 4e-42 Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 127 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 125 / 4e-37 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 94 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 94 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042946 [exp] 289 / 1e-101 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 226 / 2e-76 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 225 / 4e-76 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10028531 [exp] 178 / 2e-57 AT5G17450 207 / 1e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10009115 [exp] 176 / 1e-56 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016436 [exp] 169 / 8e-54 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 169 / 8e-54 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 158 / 9e-50 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10028426 [exp] 152 / 3e-47 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G114600 [exp] 215 / 2e-72 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 182 / 3e-59 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.005G079800 [exp] 158 / 6e-50 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 154 / 2e-48 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G175400 [exp] 148 / 5e-46 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G167000 [exp] 146 / 3e-45 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G110400 [exp] 145 / 8e-45 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 144 / 4e-44 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G135300 [exp] 144 / 4e-44 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G003700 [exp] 137 / 2e-41 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10032446 pacid=23146402 polypeptide=Lus10032446 locus=Lus10032446.g ID=Lus10032446.BGIv1.0 annot-version=v1.0 ATGGGGGCTCTGGACTCTGTTTCAGATTACTTGTCAGAGTTATTTAGAATCGCCAAGAACAAGAGGAAGCGCAAGCAAATGGCGGTGAGTGCATTCTATC CATGCATCAATGTTTCTTCTCTACGCTTTCCAACCGAGGAATCACCGCTGAACGAACTTAGGCCACCGTCTATAATTCTTCCGTTTGCAATCTATACAGT AGAGATCAAAGTAAAAATGGACTGCGATGGATGCGAGAGGAAAGTCAGGAATTCTGTCAAGCACATGAAAGGGGTGAAATCAGTGGAGCTGAGCAGAAAA CAGAGCAGGCTAACGGTGAAGGGATACGTGGAACCGAAGAAGGTGCTGAAGAGGGTTACAAACACAGGGAAGAAGGCAGAGTTTTGGCCTTACGTTCAGT ACAATCTTGTCAGTTATCCTTACGTCGCCGGAGCTTATGACAAGAAGGCTCCCTCCGGTTACGTCAGAAACGTCCCGCAAGCCCTTCCCAGCTCCTCCGA CACCGGCGAGACCTTGACTTCCTTGTTCAGCGACGACAACCCAAATGCCTGCTCCGTTATGTAG
AA sequence Show only first row Show all	>Lus10032446 pacid=23146402 polypeptide=Lus10032446 locus=Lus10032446.g ID=Lus10032446.BGIv1.0 annot-version=v1.0 MGALDSVSDYLSELFRIAKNKRKRKQMAVSAFYPCINVSSLRFPTEESPLNELRPPSIILPFAIYTVEIKVKMDCDGCERKVRNSVKHMKGVKSVELSRK QSRLTVKGYVEPKKVLKRVTNTGKKAEFWPYVQYNLVSYPYVAGAYDKKAPSGYVRNVPQALPSSSDTGETLTSLFSDDNPNACSVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10032446 [exp]	0	1
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10032169 [exp]	3.6	0.8998
AT5G51810		AT2353, GA20OX2...	gibberellin 20 oxidase 2 (.1)		Lus10041390 [exp]	5.5	0.8810
AT1G47670			Transmembrane amino acid trans...		Lus10015997 [exp]	5.9	0.8605
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10042946 [exp]	6.5	0.8838
AT3G20410		CPK9	calmodulin-domain protein kina...		Lus10032640 [exp]	9.6	0.8704
AT5G25250			SPFH/Band 7/PHB domain-contain...		Lus10001944 [exp]	10.6	0.8067
AT2G29640		JOSL	JOSEPHIN-like protein (.1)		Lus10040691 [exp]	10.7	0.8517
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Lus10000546 [exp]	13.2	0.8466
AT1G67540			unknown protein		Lus10037003 [exp]	13.7	0.8303
					Lus10041943 [exp]	17.0	0.8362

Compare expression of checked genes

Lus10032446 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.