Lus10032461 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18570 121 / 3e-35 Oleosin family protein (.1)
AT1G48990 101 / 3e-27 Oleosin family protein (.1)
AT2G25890 70 / 2e-15 Oleosin family protein (.1)
AT4G25140 66 / 7e-14 OLE1, OLEO1 oleosin 1 (.1)
AT5G51210 54 / 1e-09 OLEO3 oleosin3 (.1)
AT3G27660 53 / 7e-09 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
AT5G40420 53 / 1e-08 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT3G01570 49 / 2e-07 Oleosin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042957 297 / 3e-104 AT3G18570 139 / 2e-42 Oleosin family protein (.1)
Lus10017992 157 / 8e-49 AT3G18570 136 / 4e-41 Oleosin family protein (.1)
Lus10041987 152 / 4e-47 AT3G18570 129 / 2e-38 Oleosin family protein (.1)
Lus10027161 79 / 9e-19 AT4G25140 154 / 3e-48 oleosin 1 (.1)
Lus10039683 76 / 8e-18 AT4G25140 159 / 2e-50 oleosin 1 (.1)
Lus10031387 72 / 4e-16 AT4G25140 164 / 1e-52 oleosin 1 (.1)
Lus10022141 74 / 8e-16 AT4G25140 106 / 3e-28 oleosin 1 (.1)
Lus10017460 71 / 9e-16 AT4G25140 136 / 9e-42 oleosin 1 (.1)
Lus10010943 74 / 2e-15 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G059400 138 / 6e-42 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
Potri.006G234900 91 / 1e-23 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.018G057800 78 / 1e-18 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.001G080000 74 / 4e-17 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.003G150600 67 / 1e-14 AT4G25140 124 / 3e-37 oleosin 1 (.1)
Potri.T125308 55 / 1e-09 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.015G081901 55 / 1e-09 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.001G345800 54 / 2e-09 AT3G01570 140 / 6e-43 Oleosin family protein (.1)
Potri.012G083400 50 / 8e-08 AT5G40420 97 / 2e-25 oleosin 2 (.1)
Potri.017G071800 46 / 1e-06 AT3G01570 130 / 4e-39 Oleosin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Lus10032461 pacid=23146296 polypeptide=Lus10032461 locus=Lus10032461.g ID=Lus10032461.BGIv1.0 annot-version=v1.0
ATGGCCGGCGAGTACAACGGGACAGGCGTCCCAAGGCCAACGAGGCCAATCGCCGTCGTCGAAGCCGACAAAGACAACAACAAATGCACAACGACGACGA
CGACATTCCTCCGGAAAGCACAAAGCAGCTGGCGACAACACTGCAACCCGCCGATCACGTCGACTCAGCTGGTGGGCCTTTTGACCCTCTTATTATCGGG
AACTATTCTGATCGTCTTCACGGGCCTGACAATAACAATGGCCATTCTCACCCTCATCTTCTTCGGCCCACTTCTGATCTTATCCAGCCCAATATGGATC
CCCGTCGGCACGCTTCTCTTCGTCCTCGTCTCTGGCTTTCTGACGCTCTGCGGATGCTTCGTGGCGTTCGTGGCCGGGTTGGCGTGGACGTATAGGTATT
TCAAAGGGATGAATCCGCCCGGTTCGGATCAGGTGGATTACGCTCGGACCCGGATCTACGACACCGCCACCCATGTGAAGGATTGTGCCAAAGAATATGG
TGGGTACCTGCAGAGCAAGTCCAAGGATGCTGCTCCTGGAGCGTAG
AA sequence
>Lus10032461 pacid=23146296 polypeptide=Lus10032461 locus=Lus10032461.g ID=Lus10032461.BGIv1.0 annot-version=v1.0
MAGEYNGTGVPRPTRPIAVVEADKDNNKCTTTTTTFLRKAQSSWRQHCNPPITSTQLVGLLTLLLSGTILIVFTGLTITMAILTLIFFGPLLILSSPIWI
PVGTLLFVLVSGFLTLCGCFVAFVAGLAWTYRYFKGMNPPGSDQVDYARTRIYDTATHVKDCAKEYGGYLQSKSKDAAPGA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18570 Oleosin family protein (.1) Lus10032461 0 1
AT4G26466 LRE lorelei (.1) Lus10011066 2.4 0.8650
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10023036 4.7 0.7913
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Lus10020358 5.5 0.6090
AT1G06340 Plant Tudor-like protein (.1) Lus10039027 5.7 0.7913
AT5G36220 CYP91A1, CYP81D... CYTOCHROME P450 91A1, cytochro... Lus10018718 6.6 0.7913
AT5G25940 early nodulin-related (.1) Lus10043290 7.0 0.7051
AT2G44220 Protein of Unknown Function (D... Lus10006862 7.4 0.7913
Lus10010518 7.9 0.6632
AT4G05200 CRK25 cysteine-rich RLK (RECEPTOR-li... Lus10026169 8.1 0.7913
AT5G28823 unknown protein Lus10040056 9.4 0.6735

Lus10032461 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.