Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G54640 162 / 1e-52 ATHTA1, HTA1, RAT5 RESISTANT TO AGROBACTERIUM TRANSFORMATION 5, histone H2A 1, Histone superfamily protein (.1) AT1G51060 161 / 5e-52 HTA10 histone H2A 10 (.1) AT4G27230 160 / 6e-52 HTA2 histone H2A 2 (.1.2) AT3G20670 156 / 3e-50 HTA13 histone H2A 13 (.1) AT1G54690 145 / 7e-46 HTA3 ,G-H2AX ,GAMMA-H2AX ,H2AXB histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) AT1G08880 145 / 2e-45 HTA5 ,G-H2AX ,GAMMA-H2AX ,H2AXA histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) AT5G59870 120 / 6e-36 HTA6 histone H2A 6 (.1) AT5G02560 115 / 9e-34 HTA12 histone H2A 12 (.1.2) AT5G27670 112 / 1e-32 HTA7 histone H2A 7 (.1) AT1G52740 77 / 7e-19 HTA9 histone H2A protein 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042960 [exp] 169 / 4e-55 AT1G51060 243 / 2e-84 histone H2A 10 (.1) Lus10039691 [exp] 145 / 7e-46 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10027154 [exp] 145 / 7e-46 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10002253 [exp] 142 / 3e-44 AT1G54690 244 / 9e-85 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10003750 [exp] 137 / 3e-42 AT1G54690 239 / 7e-83 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10028044 [exp] 134 / 2e-41 AT1G08880 238 / 4e-82 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Lus10040853 [exp] 119 / 6e-35 AT5G02560 228 / 4e-78 histone H2A 12 (.1.2) Lus10005892 [exp] 118 / 6e-35 AT5G02560 230 / 1e-78 histone H2A 12 (.1.2) Lus10005444 [exp] 118 / 7e-35 AT5G02560 234 / 2e-80 histone H2A 12 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G131400 [exp] 164 / 3e-53 AT1G51060 200 / 1e-67 histone H2A 10 (.1) Potri.001G415700 [exp] 164 / 1e-52 AT1G51060 174 / 1e-56 histone H2A 10 (.1) Potri.004G031300 [exp] 152 / 8e-49 AT1G08880 150 / 6e-48 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.013G028900 [exp] 143 / 1e-44 AT1G54690 220 / 4e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040800 [exp] 142 / 1e-44 AT1G54690 221 / 2e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040700 [exp] 137 / 2e-42 AT1G08880 183 / 2e-60 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.013G028800 [exp] 134 / 4e-41 AT1G08880 190 / 2e-63 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.005G026500 [exp] 120 / 1e-35 AT5G27670 145 / 2e-45 histone H2A 7 (.1) Potri.013G018200 [exp] 120 / 1e-35 AT5G27670 160 / 4e-51 histone H2A 7 (.1) Potri.006G082300 [exp] 118 / 5e-35 AT5G02560 143 / 2e-44 histone H2A 12 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10032464 pacid=23146211 polypeptide=Lus10032464 locus=Lus10032464.g ID=Lus10032464.BGIv1.0 annot-version=v1.0 ATGGCAGGTAGAGGGAAAACCCTAGGCTCCGGTGCCTCCAAGAAGGCGACCTCCAGAAGCAGCAAGGCTGGTCTGCAGTTCCCCGTCGGCCGTATCGCTA GGTTCTTGAAGGCCGGCAAGTACGCCGAGCGTGTTGGTGCCGGCGCTCCTGTCTATCTCGCGGCCGTCCTCGAGTACCTTGCTGCTGAGGTTCTTGAATT GGCCGGAAACGCAGCGAGAGATAACAAGAAGACCAGGATTGTCCCCCGCCACATCCAGCTAGCGGTGAGGAACGACGAGGAATTGAGCAAGCTTCTTGGA GATGTGACGATTGCCAACGGTGGTGTGATGCCCAACATCCACAACCTTCTCCTCCCGAAGAAGGCCGCTGGCTCTGGATCGAAGGCTTCTGCTGACGACG AGAGCTAA
AA sequence Show only first row Show all	>Lus10032464 pacid=23146211 polypeptide=Lus10032464 locus=Lus10032464.g ID=Lus10032464.BGIv1.0 annot-version=v1.0 MAGRGKTLGSGASKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLG DVTIANGGVMPNIHNLLLPKKAAGSGSKASADDES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G51060		HTA10	histone H2A 10 (.1)		Lus10032464 [exp]	0	1
AT3G45980		H2B, HTB9	HISTONE H2B, Histone superfami...		Lus10013544 [exp]	2.2	0.9570
AT3G54560		HTA11	histone H2A 11 (.1)		Lus10018753 [exp]	4.2	0.9451
AT5G08180			Ribosomal protein L7Ae/L30e/S1...		Lus10004366 [exp]	4.7	0.9147
AT3G53730			Histone superfamily protein (....		Lus10023331 [exp]	4.9	0.9391
AT4G21110			G10 family protein (.1)		Lus10014385 [exp]	6.2	0.8862
AT5G08180			Ribosomal protein L7Ae/L30e/S1...		Lus10040161 [exp]	6.3	0.9177
AT3G45980		H2B, HTB9	HISTONE H2B, Histone superfami...		Lus10040855 [exp]	6.6	0.9020
AT1G08880		HTA5 ,G-H2AX ,G...	histone H2A 5, gamma histone v...		Lus10028044 [exp]	7.7	0.9315
AT5G59970			Histone superfamily protein (....		Lus10028464 [exp]	8.4	0.9279
AT3G53730			Histone superfamily protein (....		Lus10005898 [exp]	9.8	0.9071

Compare expression of checked genes

Lus10032464 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.