Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G42860 38 / 0.0003 zinc knuckle (CCHC-type) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014888 [exp] 142 / 3e-45 ND 39 / 7e-04 Lus10004093 [exp] 124 / 3e-38 ND 39 / 6e-04 Lus10029497 [exp] 122 / 9e-37 ND / Lus10022142 [exp] 111 / 2e-33 ND / Lus10029656 [exp] 96 / 3e-27 ND / Lus10011629 [exp] 94 / 7e-26 ND 39 / 6e-04 Lus10023773 [exp] 94 / 7e-26 ND / Lus10019608 [exp] 49 / 8e-09 ND / Lus10020975 [exp] 44 / 2e-06 AT5G13920 42 / 5e-05 GRF zinc finger / Zinc knuckle protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G094001 [exp] 42 / 1e-05 AT3G42860 44 / 3e-05 zinc knuckle (CCHC-type) family protein (.1) Potri.009G112676 [exp] 38 / 0.0003 AT5G13920 116 / 7e-28 GRF zinc finger / Zinc knuckle protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF06839 [flax] [poplar] zf-GRF GRF zinc finger
Representative CDS sequence Show only first row Show all	>Lus10032472 pacid=23146217 polypeptide=Lus10032472 locus=Lus10032472.g ID=Lus10032472.BGIv1.0 annot-version=v1.0 ATGACCTTCTCCAAGGAAGAATTTAGCTACGAGGACGATGAAGTGTTGTGCCACTACGGCTTGTGGGCGTCTAGACGTATATCGCACACGTCCACGAACC CGGGAAAGAAATTTTTTGGATGCCCCCGATATGTGTCTCAGGTGGAGAAAGGATGTGGGTTCTTTCTTTGGTACCACGTTAAGGTTGCAGGTGTGAAAGA CAAGCAAGAACTTGTTGAAATGGTTGAGAGGTTGCAACTCCACGTGCAGGAGCTAGAACGGGCGAATATAGAGCTGTAA
AA sequence Show only first row Show all	>Lus10032472 pacid=23146217 polypeptide=Lus10032472 locus=Lus10032472.g ID=Lus10032472.BGIv1.0 annot-version=v1.0 MTFSKEEFSYEDDEVLCHYGLWASRRISHTSTNPGKKFFGCPRYVSQVEKGCGFFLWYHVKVAGVKDKQELVEMVERLQLHVQELERANIEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032472 [exp]	0	1
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Lus10011998 [exp]	1.7	0.9934
AT1G15910		FDM1	factor of DNA methylation 1, X...		Lus10040287 [exp]	2.4	0.9913
AT3G56570			SET domain-containing protein ...		Lus10029539 [exp]	3.0	0.9913
AT3G61230	LIM	PLIM2c	PLIM2c, GATA type zinc finger ...		Lus10029859 [exp]	3.5	0.9732
AT5G27870			Plant invertase/pectin methyle...		Lus10037489 [exp]	3.9	0.9772
AT1G74920		ALDH10A8	aldehyde dehydrogenase 10A8 (....		Lus10004239 [exp]	4.0	0.9655
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Lus10002775 [exp]	4.2	0.9645
AT2G45010			PLAC8 family protein (.1.2)		Lus10042885 [exp]	4.5	0.9778
AT5G15430			Plant calmodulin-binding prote...		Lus10015733 [exp]	5.8	0.9382
					Lus10018443 [exp]	6.0	0.9356

Compare expression of checked genes

Lus10032472 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.