Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18510 79 / 1e-21 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042971 [exp] 116 / 2e-36 AT3G18510 82 / 1e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G140300 [exp] 78 / 3e-21 AT3G18510 39 / 1e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032475 pacid=23146417 polypeptide=Lus10032475 locus=Lus10032475.g ID=Lus10032475.BGIv1.0 annot-version=v1.0 ATGGCGTTGGGTTCAAAGAAATGGGGTTATATGCGGATCATCACCGGAACAATCTTCGGCGGTGCTCTCGGGTTCTATGTTATGCACCGTATGGAGCTCA GCTACAAGGAGAAGATGAACGAGAGACTGAGGCAATACGAGATTGAGCTCAAGAAGAAAGAAGAAGCCAATAATAAGTTCGACGAATCCCTCTAG
AA sequence Show only first row Show all	>Lus10032475 pacid=23146417 polypeptide=Lus10032475 locus=Lus10032475.g ID=Lus10032475.BGIv1.0 annot-version=v1.0 MALGSKKWGYMRIITGTIFGGALGFYVMHRMELSYKEKMNERLRQYEIELKKKEEANNKFDESL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18510			unknown protein		Lus10032475 [exp]	0	1
AT2G42680		MBF1A, ATMBF1A	ARABIDOPSIS THALIANA MULTIPROT...		Lus10000056 [exp]	1.7	0.8898
AT1G47820			unknown protein		Lus10035088 [exp]	1.7	0.8795
AT3G06610			DNA-binding enhancer protein-r...		Lus10037773 [exp]	2.4	0.8875
AT5G14240			Thioredoxin superfamily protei...		Lus10032064 [exp]	3.7	0.8506
AT5G51510			unknown protein		Lus10027200 [exp]	5.7	0.8706
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030583 [exp]	6.3	0.8698
AT1G67620			Lojap-related protein (.1)		Lus10015822 [exp]	6.5	0.8542
AT4G22330		ATCES1	Alkaline phytoceramidase (aPHC...		Lus10032606 [exp]	7.1	0.8353
AT5G18475			Pentatricopeptide repeat (PPR)...		Lus10041927 [exp]	7.5	0.7869
AT1G07840			Sas10/Utp3/C1D family (.1.2.3)		Lus10029397 [exp]	8.8	0.8438

Compare expression of checked genes

Lus10032475 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.