Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25720 91 / 1e-24 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042976 [exp] 142 / 1e-44 AT2G25720 111 / 1e-32 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G068400 [exp] 91 / 1e-24 AT2G25720 110 / 1e-32 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032479 pacid=23146411 polypeptide=Lus10032479 locus=Lus10032479.g ID=Lus10032479.BGIv1.0 annot-version=v1.0 ATGTCGGATGCGTACGAGAGAACGAAAGCAGGCAGGCTATCCTTTAAGGGAGGGGAAGTCGCCGTTACTAGTAAAGCCATCTCCAAGAAGAAGAAGAAGA AAGCAAAGAAACAGCAGCACGCCGCAGAATTGAACGACGGCGGCGATGGGAAAGAGCACTTGGAAGGCGGCGAAGGCGGCGCTGCAGCAGCAGGAGGAGG AGAAGGAGCTAGCGATGGCGGCGAATTAGTTTATACCATTGACGCGGCGAAGAAGAAGAAGTACGAGGATCTTTTCCCTGTGGAGGCGAAGAAATTCGGG TACGATCCTAAGGCCAAGGAGAAGAAGGTTGAGGAGGCTCTGGATGATCGCGTGAAGAAGAAGGCTGATCGCTACTGTAAATGA
AA sequence Show only first row Show all	>Lus10032479 pacid=23146411 polypeptide=Lus10032479 locus=Lus10032479.g ID=Lus10032479.BGIv1.0 annot-version=v1.0 MSDAYERTKAGRLSFKGGEVAVTSKAISKKKKKKAKKQQHAAELNDGGDGKEHLEGGEGGAAAAGGGEGASDGGELVYTIDAAKKKKYEDLFPVEAKKFG YDPKAKEKKVEEALDDRVKKKADRYCK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25720			unknown protein		Lus10032479 [exp]	0	1
AT4G34630			unknown protein		Lus10028793 [exp]	1.4	0.8242
AT5G49210			unknown protein		Lus10043148 [exp]	1.7	0.7887
AT1G27435			unknown protein		Lus10012558 [exp]	3.9	0.7508
AT2G33845			Nucleic acid-binding, OB-fold-...		Lus10015411 [exp]	5.5	0.7912
AT2G02510			NADH dehydrogenase (ubiquinone...		Lus10005182 [exp]	6.3	0.7676
AT2G15980			Tetratricopeptide repeat (TPR)...		Lus10020712 [exp]	7.1	0.7841
AT4G01260	GeBP		DNA-binding storekeeper protei...		Lus10004772 [exp]	7.2	0.7867
AT4G40045			unknown protein		Lus10034155 [exp]	7.7	0.7839
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10032561 [exp]	10.2	0.7833
AT5G62030			diphthamide synthesis DPH2 fam...		Lus10039108 [exp]	11.5	0.7661

Compare expression of checked genes

Lus10032479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.