Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18490 125 / 9e-36 Eukaryotic aspartyl protease family protein (.1) AT1G25510 121 / 4e-34 Eukaryotic aspartyl protease family protein (.1) AT3G61820 107 / 3e-29 Eukaryotic aspartyl protease family protein (.1) AT1G01300 98 / 1e-25 Eukaryotic aspartyl protease family protein (.1) AT3G20015 94 / 5e-24 Eukaryotic aspartyl protease family protein (.1) AT5G10760 55 / 3e-10 Eukaryotic aspartyl protease family protein (.1) AT3G59080 54 / 4e-10 Eukaryotic aspartyl protease family protein (.1.2) AT3G52500 52 / 2e-09 Eukaryotic aspartyl protease family protein (.1) AT4G16563 52 / 2e-09 Eukaryotic aspartyl protease family protein (.1) AT2G03200 50 / 1e-08 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003999 [exp] 101 / 6e-27 AT1G01300 636 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10017362 [exp] 92 / 3e-23 AT3G20015 549 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10010157 [exp] 91 / 4e-23 AT3G20015 545 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10025702 [exp] 59 / 7e-12 AT2G03200 529 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10035961 [exp] 58 / 2e-11 AT2G03200 525 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10039126 [exp] 56 / 5e-11 AT1G01300 139 / 2e-38 Eukaryotic aspartyl protease family protein (.1) Lus10020759 [exp] 56 / 7e-11 AT3G59080 386 / 1e-133 Eukaryotic aspartyl protease family protein (.1.2) Lus10007335 [exp] 55 / 3e-10 AT3G59080 698 / 0.0 Eukaryotic aspartyl protease family protein (.1.2) Lus10021292 [exp] 52 / 5e-10 AT3G52500 119 / 5e-33 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G051800 [exp] 140 / 3e-41 AT3G18490 585 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.010G128200 [exp] 116 / 2e-32 AT1G25510 622 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.014G099400 [exp] 100 / 1e-26 AT1G01300 633 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.002G171700 [exp] 100 / 2e-26 AT1G01300 642 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.005G063000 [exp] 96 / 5e-25 AT3G20015 560 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.007G106300 [exp] 96 / 8e-25 AT3G20015 575 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.008G118100 [exp] 74 / 6e-17 AT1G25510 373 / 8e-126 Eukaryotic aspartyl protease family protein (.1) Potri.005G204600 [exp] 61 / 2e-12 AT3G59080 686 / 0.0 Eukaryotic aspartyl protease family protein (.1.2) Potri.001G306200 [exp] 57 / 3e-11 AT2G03200 501 / 1e-176 Eukaryotic aspartyl protease family protein (.1) Potri.019G002100 [exp] 57 / 4e-11 AT2G03200 529 / 0.0 Eukaryotic aspartyl protease family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0129 [flax] [poplar] Peptidase_AA PF00026 [flax] [poplar] Asp Eukaryotic aspartyl protease
Representative CDS sequence Show only first row Show all	>Lus10032481 pacid=23146356 polypeptide=Lus10032481 locus=Lus10032481.g ID=Lus10032481.BGIv1.0 annot-version=v1.0 ATGTCCGGGATGTCGAGCGTGAAGGTTCCGACGGTGGCGTTCCATTTCGCCGGAGAGAAGACGTGGAACTTGCCTGCGGCGAACTACTTGATCCCGGTGG ATGGGCAAGGGACGTTCTGCTTCGCGTTCGCTCCGACGACGTCGTCTCTGTCGATAATCGGGAACGTGCAGCAGCAGGGGACGCGCGTGAGCTTCGACCT GGTTAACAACCGCGTGGGGTTCTCGACCAATAAATGTTGA
AA sequence Show only first row Show all	>Lus10032481 pacid=23146356 polypeptide=Lus10032481 locus=Lus10032481.g ID=Lus10032481.BGIv1.0 annot-version=v1.0 MSGMSSVKVPTVAFHFAGEKTWNLPAANYLIPVDGQGTFCFAFAPTTSSLSIIGNVQQQGTRVSFDLVNNRVGFSTNKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18490			Eukaryotic aspartyl protease f...		Lus10032481 [exp]	0	1
AT3G18490			Eukaryotic aspartyl protease f...		Lus10032482 [exp]	1.0	0.9483
AT4G16490			ARM repeat superfamily protein...		Lus10017562 [exp]	2.4	0.9419
AT3G21890	CO		B-box type zinc finger family ...		Lus10031583 [exp]	2.4	0.9401
AT4G25130		PMSR4	peptide met sulfoxide reductas...		Lus10032504 [exp]	2.8	0.9390
AT5G24460			unknown protein		Lus10015572 [exp]	3.7	0.9259
AT4G16490			ARM repeat superfamily protein...		Lus10017563 [exp]	4.5	0.9373
AT3G18490			Eukaryotic aspartyl protease f...		Lus10042978 [exp]	4.5	0.9168
AT5G57360		LKP1, FKL2, ADO...	ZEITLUPE, LOV KELCH PROTEIN 1,...		Lus10025470 [exp]	5.5	0.9261
AT5G51720			2 iron, 2 sulfur cluster bindi...		Lus10031686 [exp]	7.5	0.9205
AT1G66080			unknown protein		Lus10010967 [exp]	8.5	0.9174

Compare expression of checked genes

Lus10032481 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.