Lus10032486 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041395 92 / 8e-23 AT2G45590 647 / 0.0 Protein kinase superfamily protein (.1)
Lus10036533 91 / 2e-22 AT2G45590 416 / 2e-138 Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G072900 58 / 4e-11 AT2G45590 576 / 0.0 Protein kinase superfamily protein (.1)
Potri.002G150800 45 / 2e-06 AT2G45590 563 / 0.0 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10032486 pacid=23146360 polypeptide=Lus10032486 locus=Lus10032486.g ID=Lus10032486.BGIv1.0 annot-version=v1.0
ATGGAATGGACTGGGAGTGAGATCAGTAAAGAGAACAGATTGAAACCTGGATGGAATAATCTCGAATCACCAAGCTCCGTCGACAACGGTCTTTTGACGA
CGACGAGGTTTAAGATCAAGAAGAAGAAGAAAAAGATAAGGAAGCGATTGGAATGGTGGGCGTCTCTAGACGAAGAGAGGAAGATGAAGAAGAAGGAAAA
GAATCGGAAACTTAGAGGATGGTGGAAGGAAGAGTTCTGCGACGAGCTAACCAAGAAGAACGAGAAGAAAAAGAAGAAGAGAAGCAACAACAGAGGAGAA
TTTTAA
AA sequence
>Lus10032486 pacid=23146360 polypeptide=Lus10032486 locus=Lus10032486.g ID=Lus10032486.BGIv1.0 annot-version=v1.0
MEWTGSEISKENRLKPGWNNLESPSSVDNGLLTTTRFKIKKKKKKIRKRLEWWASLDEERKMKKKEKNRKLRGWWKEEFCDELTKKNEKKKKKRSNNRGE
F

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032486 0 1
AT3G07930 DNA glycosylase superfamily pr... Lus10001994 24.3 0.5792
AT5G63690 Nucleic acid-binding, OB-fold-... Lus10035799 44.3 0.5460
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Lus10018704 45.1 0.5462
AT1G79400 ATCHX2 cation/H+ exchanger 2, cation/... Lus10026155 65.5 0.5258
AT1G33810 unknown protein Lus10005295 131.9 0.4614
AT4G34131 UGT73B3 UDP-glucosyl transferase 73B3 ... Lus10014079 154.4 0.4276
Lus10012326 244.2 0.4031

Lus10032486 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.