Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73890 81 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 62 / 8e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G44290 61 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 61 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 57 / 2e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 53 / 6e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 52 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G43720 49 / 2e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G05450 48 / 5e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G14815 45 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042984 [exp] 273 / 8e-95 AT1G73890 81 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017749 [exp] 66 / 3e-13 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033076 [exp] 64 / 7e-13 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10035975 [exp] 60 / 1e-10 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1) Lus10014681 [exp] 58 / 1e-10 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042449 [exp] 56 / 8e-10 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10042611 [exp] 51 / 4e-08 AT3G22600 142 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 51 / 4e-08 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 50 / 1e-07 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G053700 [exp] 111 / 9e-31 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G054000 [exp] 111 / 9e-31 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232000 [exp] 59 / 8e-11 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G008500 [exp] 57 / 2e-10 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G217000 [exp] 54 / 3e-09 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G195700 [exp] 54 / 4e-09 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 50 / 5e-08 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 50 / 7e-08 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G131500 [exp] 47 / 6e-07 AT5G13900 122 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050200 [exp] 43 / 3e-05 AT2G48140 127 / 1e-37 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10032488 pacid=23146241 polypeptide=Lus10032488 locus=Lus10032488.g ID=Lus10032488.BGIv1.0 annot-version=v1.0 ATGGTCTGGTTCCTTTTCCTGCTACTGGCAACAGCCATAGCCACCAGTACTAGTTCGCACCAACCTCCAACCATTACCGAATGCACTCCGGGACTCCTCC AGCTCACTCCATGCGCACCATATGTGCAAGGCATTGCCTCTTCGCCACTCCAATCCTGCTGCGACGATCTCATTCAGCTCTACAAGCAGCAACCCGAATG CCTTTGCCTCATCATCACCACCCCTAACTTGGGCGGATTCCCTATCAACACCAGTCTCGCCATGCACCTCCCTTCCCTTTGCGGCATCCGCGTCAAGGAT CCCTCCACTTCTTGCTTTCCAGGTACCTCCTCATCGCCAGCTCCTCCTCTCCTGCTGCCGCCGCATGCTAATTCCTCACTTGCTTCAAACTCCACTGCTC CATCAACTGCAGTAGTTCAGATTCCACCGAGGCCGGTTATAATGGGAATGGGGATTGGTTGGAGCTCCAGAGTAATAGTTTGTAGAGAAGTTTTGATGAT GCTTCTGGTTTGGTGCCTCTTCCAGCTGTTTCTCCACCAATGA
AA sequence Show only first row Show all	>Lus10032488 pacid=23146241 polypeptide=Lus10032488 locus=Lus10032488.g ID=Lus10032488.BGIv1.0 annot-version=v1.0 MVWFLFLLLATAIATSTSSHQPPTITECTPGLLQLTPCAPYVQGIASSPLQSCCDDLIQLYKQQPECLCLIITTPNLGGFPINTSLAMHLPSLCGIRVKD PSTSCFPGTSSSPAPPLLLPPHANSSLASNSTAPSTAVVQIPPRPVIMGMGIGWSSRVIVCREVLMMLLVWCLFQLFLHQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G73890			Bifunctional inhibitor/lipid-t...		Lus10032488 [exp]	0	1
AT1G70710		CEL1 ,AtGH9B1	CELLULASE 1, glycosyl hydrolas...		Lus10027205 [exp]	1.4	0.7984
					Lus10032779 [exp]	1.7	0.7916
AT1G14590			Nucleotide-diphospho-sugar tra...		Lus10017982 [exp]	2.2	0.7743
AT3G01190			Peroxidase superfamily protein...		Lus10006756 [exp]	4.2	0.8194
AT4G35160			O-methyltransferase family pro...		Lus10032304 [exp]	4.2	0.7248
AT2G28420		GLYI8	glyoxylase I 8, Lactoylglutath...		Lus10005324 [exp]	6.9	0.7828
AT2G34740			Protein phosphatase 2C family ...		Lus10038455 [exp]	13.8	0.6687
AT1G45063			copper ion binding;electron ca...		Lus10020276 [exp]	13.9	0.6500
AT1G32730			unknown protein		Lus10000258 [exp]	14.2	0.7036
					Lus10017627 [exp]	17.7	0.6872

Compare expression of checked genes

Lus10032488 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.