Lus10032489 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G053600 42 / 8e-06 AT1G68585 56 / 3e-11 unknown protein
Potri.008G119300 41 / 2e-05 AT1G68585 97 / 3e-27 unknown protein
Potri.010G126800 41 / 4e-05 AT1G68585 92 / 3e-25 unknown protein
PFAM info
Representative CDS sequence
>Lus10032489 pacid=23146378 polypeptide=Lus10032489 locus=Lus10032489.g ID=Lus10032489.BGIv1.0 annot-version=v1.0
ATGGCTACATCTTCCCCGTCGGCTCCGCTGTCCTACTCCAAAAAGGCTGCAATTTCCCACTCCCCCGCCATTATATATATGATGGCCGGCCCCTTAGCTC
CCTACATCCATCAACTTTATTATAGAAAGATGGGATCTTGGGCAAAGAAGGAGCTCTCCAAGCTTCTGGGATCCCGCAGATTAATGCCTCCAGCTCGTCC
CCCTTTACTTCTCACCCAACCACCTCCTCATCCCCAGTTGTCACAGGATGGAGTTGTCAAGGTTGTGGTGGCGGCTGACTTGAGATGCGCCAACTGTACA
GACAGATTGGCCGATGCCATTTCAAGCTTGGAGTTGGATGCAGCAGTGGAGTCAGTCGAGGTGGATTTCGCGACAAAGGAAGTTACCCTATCACTTCGCG
GCCGATGA
AA sequence
>Lus10032489 pacid=23146378 polypeptide=Lus10032489 locus=Lus10032489.g ID=Lus10032489.BGIv1.0 annot-version=v1.0
MATSSPSAPLSYSKKAAISHSPAIIYMMAGPLAPYIHQLYYRKMGSWAKKELSKLLGSRRLMPPARPPLLLTQPPPHPQLSQDGVVKVVVAADLRCANCT
DRLADAISSLELDAAVESVEVDFATKEVTLSLRGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032489 0 1
AT5G60920 COB COBRA-like extracellular glyco... Lus10007986 2.4 0.6924
AT2G21540 ATSFH3 SEC14-like 3 (.1.2.3) Lus10026355 8.2 0.7323
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10008522 9.8 0.6680
AT2G17280 Phosphoglycerate mutase family... Lus10032820 10.2 0.6392
AT5G50400 ATPAP27, PAP27 ARABIDOPSIS THALIANA PURPLE AC... Lus10024179 20.1 0.6317
AT3G07700 Protein kinase superfamily pro... Lus10012317 20.1 0.5922
AT4G01070 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYL... Lus10003897 25.0 0.6366
AT1G62810 Copper amine oxidase family pr... Lus10024568 31.6 0.6536
AT3G06580 GAL1, GALK GALACTOSE KINASE 1, Mevalonate... Lus10017072 31.7 0.5743
AT4G34810 SAUR-like auxin-responsive pro... Lus10042379 34.6 0.6494

Lus10032489 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.