Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47950 64 / 7e-13 HXXXD-type acyl-transferase family protein (.1) AT4G15390 63 / 1e-12 HXXXD-type acyl-transferase family protein (.1) AT3G30280 62 / 3e-12 HXXXD-type acyl-transferase family protein (.1) AT1G24420 57 / 3e-10 HXXXD-type acyl-transferase family protein (.1) AT1G24430 54 / 3e-09 HXXXD-type acyl-transferase family protein (.1) AT3G26040 51 / 2e-08 HXXXD-type acyl-transferase family protein (.1) AT3G48720 49 / 1e-07 DCF DEFICIENT IN CUTIN FERULATE, HXXXD-type acyl-transferase family protein (.1) AT3G29670 46 / 1e-06 PMAT2 phenolic glucoside malonyltransferase 2, HXXXD-type acyl-transferase family protein (.1) AT5G63560 45 / 2e-06 HXXXD-type acyl-transferase family protein (.1) AT3G23840 45 / 4e-06 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042994 [exp] 207 / 1e-66 AT3G26040 184 / 3e-53 HXXXD-type acyl-transferase family protein (.1) Lus10016353 [exp] 160 / 4e-48 AT3G26040 201 / 1e-59 HXXXD-type acyl-transferase family protein (.1) Lus10000319 [exp] 149 / 8e-44 AT3G26040 198 / 2e-58 HXXXD-type acyl-transferase family protein (.1) Lus10004441 [exp] 137 / 1e-39 AT3G26040 196 / 2e-57 HXXXD-type acyl-transferase family protein (.1) Lus10017702 [exp] 128 / 1e-37 AT4G15390 118 / 1e-30 HXXXD-type acyl-transferase family protein (.1) Lus10012759 [exp] 127 / 1e-35 AT3G26040 209 / 3e-62 HXXXD-type acyl-transferase family protein (.1) Lus10002893 [exp] 118 / 3e-32 AT5G47950 195 / 2e-57 HXXXD-type acyl-transferase family protein (.1) Lus10025867 [exp] 110 / 4e-30 AT3G26040 155 / 2e-43 HXXXD-type acyl-transferase family protein (.1) Lus10029647 [exp] 89 / 2e-23 AT3G30280 54 / 3e-09 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G124184 [exp] 93 / 3e-23 AT3G26040 278 / 5e-89 HXXXD-type acyl-transferase family protein (.1) Potri.011G124300 [exp] 93 / 3e-23 AT3G26040 278 / 5e-89 HXXXD-type acyl-transferase family protein (.1) Potri.011G124268 [exp] 92 / 5e-23 AT3G26040 281 / 2e-90 HXXXD-type acyl-transferase family protein (.1) Potri.011G124500 [exp] 92 / 5e-23 AT3G26040 281 / 2e-90 HXXXD-type acyl-transferase family protein (.1) Potri.011G124128 [exp] 91 / 2e-22 AT3G26040 282 / 1e-90 HXXXD-type acyl-transferase family protein (.1) Potri.011G124156 [exp] 91 / 2e-22 AT3G26040 284 / 2e-91 HXXXD-type acyl-transferase family protein (.1) Potri.008G033500 [exp] 84 / 1e-19 AT3G26040 290 / 3e-93 HXXXD-type acyl-transferase family protein (.1) Potri.008G034300 [exp] 78 / 6e-18 AT3G26040 280 / 1e-89 HXXXD-type acyl-transferase family protein (.1) Potri.008G034200 [exp] 74 / 2e-16 AT3G26040 254 / 9e-80 HXXXD-type acyl-transferase family protein (.1) Potri.008G034100 [exp] 73 / 4e-16 AT3G26040 270 / 4e-86 HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10032497 pacid=23146407 polypeptide=Lus10032497 locus=Lus10032497.g ID=Lus10032497.BGIv1.0 annot-version=v1.0 ATGATGGTCCGCAACTTCCATCAAGGAGTCCCATTCATGGAAGCTAGAATCCAAGGCCAACACCTAGTTGATTACTTGCAACCACCCAAAATGGAACTCC TCCATAACCTTGTCCCCTTGGAGCCTTTGTCTATTGGCAACTTAACAGATGGCCCCCAGATTTCGGTGCAGCTCAACACATTCGACTGTGGTGGGATTGC CCTTGGTTTGAGCTTGAGCCACCAACTCATAGATGGTGGCACTTTCAGCGCATTCCTCAAGACATGGGTGGCTTACTCGATTAATCCTAATGTTATATAT TTTGATCATGCTCCGGATTTATTCAGTGGGTCGTCTGTTTTCCCACTCAACAGAGTAATGAATCTCACTACATGA
AA sequence Show only first row Show all	>Lus10032497 pacid=23146407 polypeptide=Lus10032497 locus=Lus10032497.g ID=Lus10032497.BGIv1.0 annot-version=v1.0 MMVRNFHQGVPFMEARIQGQHLVDYLQPPKMELLHNLVPLEPLSIGNLTDGPQISVQLNTFDCGGIALGLSLSHQLIDGGTFSAFLKTWVAYSINPNVIY FDHAPDLFSGSSVFPLNRVMNLTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15390			HXXXD-type acyl-transferase fa...		Lus10032497 [exp]	0	1
AT4G32090			Beta-1,3-N-Acetylglucosaminylt...		Lus10012177 [exp]	2.2	0.9322
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10030261 [exp]	7.9	0.8918
AT5G46230			Protein of unknown function, D...		Lus10000355 [exp]	15.5	0.8765
AT1G66140	C2H2ZnF	ZFP4	zinc finger protein 4 (.1)		Lus10035169 [exp]	16.9	0.8785
AT2G37360		ABCG2	ATP-binding cassette G2, ABC-2...		Lus10018624 [exp]	23.1	0.8761
AT2G40390			unknown protein		Lus10009844 [exp]	23.2	0.8645
AT4G03010			RNI-like superfamily protein (...		Lus10033744 [exp]	31.2	0.8596
AT4G28110	MYB	ATMYB41	myb domain protein 41 (.1)		Lus10031607 [exp]	32.7	0.8596
AT3G54670		ATSMC1, TTN8	TITAN8, STRUCTURAL MAINTENANCE...		Lus10013583 [exp]	34.6	0.7422
AT1G53903			Protein of unknown function (D...		Lus10003939 [exp]	35.2	0.8572

Compare expression of checked genes

Lus10032497 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.