Lus10032505 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44740 220 / 6e-73 CYCP4;1 cyclin p4;1 (.1)
AT5G61650 209 / 3e-68 CYCP4;2 CYCLIN P4;2 (.1)
AT5G07450 194 / 3e-62 CYCP4;3 cyclin p4;3 (.1)
AT3G60550 141 / 2e-41 CYCP3;2 cyclin p3;2 (.1)
AT3G63120 140 / 3e-41 CYCP1;1 cyclin p1;1 (.1)
AT3G21870 138 / 2e-40 CYCP2;1 cyclin p2;1 (.1)
AT3G05327 135 / 1e-39 Cyclin family protein (.1)
AT2G45080 129 / 7e-37 CYCP3;1 cyclin p3;1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043003 350 / 1e-123 AT2G44740 227 / 2e-75 cyclin p4;1 (.1)
Lus10022038 166 / 5e-51 AT3G63120 197 / 8e-64 cyclin p1;1 (.1)
Lus10039697 160 / 4e-49 AT3G21870 236 / 3e-79 cyclin p2;1 (.1)
Lus10042582 160 / 5e-49 AT3G63120 191 / 2e-61 cyclin p1;1 (.1)
Lus10027148 161 / 1e-48 AT3G21870 233 / 6e-77 cyclin p2;1 (.1)
Lus10004475 154 / 8e-47 AT3G05327 171 / 1e-53 Cyclin family protein (.1)
Lus10029933 153 / 3e-46 AT3G05327 172 / 3e-54 Cyclin family protein (.1)
Lus10042873 140 / 4e-41 AT3G60550 300 / 8e-104 cyclin p3;2 (.1)
Lus10028174 135 / 2e-39 AT2G45080 249 / 1e-84 cyclin p3;1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G050400 248 / 6e-84 AT2G44740 285 / 8e-99 cyclin p4;1 (.1)
Potri.012G114600 240 / 3e-80 AT2G44740 277 / 2e-95 cyclin p4;1 (.1)
Potri.015G112140 236 / 2e-79 AT2G44740 274 / 1e-94 cyclin p4;1 (.1)
Potri.002G052800 167 / 2e-51 AT3G63120 219 / 1e-71 cyclin p1;1 (.1)
Potri.005G209800 165 / 5e-51 AT3G63120 223 / 7e-74 cyclin p1;1 (.1)
Potri.007G121500 158 / 3e-48 AT3G21870 228 / 5e-76 cyclin p2;1 (.1)
Potri.013G023000 147 / 2e-44 AT3G05327 194 / 4e-63 Cyclin family protein (.1)
Potri.005G033600 142 / 6e-42 AT3G05327 184 / 5e-59 Cyclin family protein (.1)
Potri.014G066400 138 / 2e-40 AT3G60550 343 / 3e-121 cyclin p3;2 (.1)
Potri.002G143400 138 / 3e-40 AT2G45080 324 / 1e-113 cyclin p3;1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0065 Cyclin PF08613 Cyclin Cyclin
Representative CDS sequence
>Lus10032505 pacid=23146419 polypeptide=Lus10032505 locus=Lus10032505.g ID=Lus10032505.BGIv1.0 annot-version=v1.0
ATGGCGGGAAGAGATCTGGAGGAGAGATATCCGCCGTCGACGCCCAAAGTGATAAGGTTCCTGTCTTGTCTGCTGCAGCGAGTGGCTCATTCCAATGATT
TGAGAATCAAAACCCAAATTGGCGGCTCTTCTTCTTCCGCCGCAATCTCCTCCATCTTCCACGGTCTGACTCCGCCGTCAATTTCCATCCATAGCTACCT
CGGCAGGATATTCAGCTACGCCAATTGTAGTCCTTCTTGCTTTGTCGTCGCCTATGTCTATCTGGATCGGTTCGTTCAGAAGCAGCCGTCTCTTCCCATC
ACTTCTCTCAACGTCCATCGCCTCCTCATTACCAGCGTCTTGGTCTCCGTCAAGTTCATGGACGACATATACTACAACAATGCGTACTACGCAAAAGTAG
GAGGGATCAGCAGAGCAGAGATGAACATGATGGAAGTGGATTTCCTGTTCGGGATAGGATTCGATTTAAACGTGACTCCAACCACCTTCCACACTTACTG
CTCTCACCTCAACACCCTGCAGATGCCATTTCTCCAACCTCCTCCTAATTTACATGACCTTCTCCTACATCCAACTCCCGATAACATCATGCAGCCTACC
GCATCAGCCGCCGTCGCCAGATCGTCATCAAAGCAGCAGCTACCACACCATTGTTGCCACAACGAAGACGACTCAGCTCACCATCAACAGCTTGCCGTTT
GA
AA sequence
>Lus10032505 pacid=23146419 polypeptide=Lus10032505 locus=Lus10032505.g ID=Lus10032505.BGIv1.0 annot-version=v1.0
MAGRDLEERYPPSTPKVIRFLSCLLQRVAHSNDLRIKTQIGGSSSSAAISSIFHGLTPPSISIHSYLGRIFSYANCSPSCFVVAYVYLDRFVQKQPSLPI
TSLNVHRLLITSVLVSVKFMDDIYYNNAYYAKVGGISRAEMNMMEVDFLFGIGFDLNVTPTTFHTYCSHLNTLQMPFLQPPPNLHDLLLHPTPDNIMQPT
ASAAVARSSSKQQLPHHCCHNEDDSAHHQQLAV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44740 CYCP4;1 cyclin p4;1 (.1) Lus10032505 0 1
AT1G47740 PPPDE putative thiol peptidase... Lus10040485 2.0 0.9339
AT2G44740 CYCP4;1 cyclin p4;1 (.1) Lus10043003 2.2 0.9569
AT3G16850 Pectin lyase-like superfamily ... Lus10016837 5.1 0.9474
AT1G76240 Arabidopsis protein of unknown... Lus10016005 7.1 0.9420
AT1G19440 KCS4 3-ketoacyl-CoA synthase 4 (.1) Lus10026345 7.3 0.9070
AT2G29390 ATSMO2-2, SMO2-... Arabidopsis thaliana sterol 4-... Lus10040739 12.0 0.8910
AT2G20520 FLA6 FASCICLIN-like arabinogalactan... Lus10017696 12.2 0.9319
AT2G35880 TPX2 (targeting protein for Xk... Lus10016193 14.9 0.8587
AT5G40390 RS5, SIP1 seed imbibition 1-like, raffin... Lus10027679 15.0 0.9205
AT1G64640 AtENODL8 early nodulin-like protein 8 (... Lus10033227 17.1 0.9305

Lus10032505 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.