Lus10032507 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043004 46 / 3e-06 ND 47 / 8e-06
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10032507 pacid=23146289 polypeptide=Lus10032507 locus=Lus10032507.g ID=Lus10032507.BGIv1.0 annot-version=v1.0
ATGTCACCTTCCTTCCTCTACTTTTTTCTTTTCCTCTTCTTCGTCCCAAACCTCTTTGTAGCTGCTCGCAACAAGATTGATCATCCGAACCATCAGATCA
CAACCGGTCAAAAGATGGATCATCCCACGGCTCAGACCACTGGTTCATCCGGCTCGTCCCACGGACCCAATTGGGATTTCAGTTGGGGGTGGGGCTCTAC
TCCAGGTACTGGTTGGGGTTATGGCTCTGGATCAGCTCGAACCCCTAATGGATTCGCGAGGGGCTCTGGCTACGGATTCGGGTCTGGCTCTGGATCCGGG
TCCGGATCCGGCTATGGGTATAGTTACGGGTCCGGTGGCGGCGGTGTTCGTGCGGGTGGGTATGGCGCTGGAAGTGGGGGTTCCGGAGGCGGCACTCCGC
CTGTCGACAGAAACCACCATGGCTGA
AA sequence
>Lus10032507 pacid=23146289 polypeptide=Lus10032507 locus=Lus10032507.g ID=Lus10032507.BGIv1.0 annot-version=v1.0
MSPSFLYFFLFLFFVPNLFVAARNKIDHPNHQITTGQKMDHPTAQTTGSSGSSHGPNWDFSWGWGSTPGTGWGYGSGSARTPNGFARGSGYGFGSGSGSG
SGSGYGYSYGSGGGGVRAGGYGAGSGGSGGGTPPVDRNHHG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G61660 glycine-rich protein (.1) Lus10032507 0 1
AT4G20880 ethylene-responsive nuclear pr... Lus10038459 6.0 0.8027
AT2G30933 Carbohydrate-binding X8 domain... Lus10020765 6.0 0.8220
AT5G17850 Sodium/calcium exchanger famil... Lus10005673 8.8 0.8650
AT3G06145 unknown protein Lus10004420 19.3 0.7820
AT1G11440 unknown protein Lus10018397 20.7 0.7619
AT4G16820 PLA-I{beta]2 phospholipase A I beta 2, alph... Lus10004364 20.8 0.8406
AT3G22970 Protein of unknown function (D... Lus10003087 27.6 0.7989
AT3G13480 unknown protein Lus10013407 28.2 0.8385
AT5G01090 Concanavalin A-like lectin fam... Lus10035542 28.8 0.8310
AT1G09070 (AT)SRC2, (AT)S... soybean gene regulated by cold... Lus10004500 30.6 0.8125

Lus10032507 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.