Lus10032529 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51020 315 / 4e-109 CAA33, CRL constitutive activator of AAA-ATPase, crumpled leaf (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043210 436 / 1e-156 AT5G51020 393 / 1e-139 constitutive activator of AAA-ATPase, crumpled leaf (.1)
Lus10016734 353 / 7e-124 AT5G51020 433 / 2e-155 constitutive activator of AAA-ATPase, crumpled leaf (.1)
Lus10022429 330 / 2e-114 AT5G51020 417 / 2e-148 constitutive activator of AAA-ATPase, crumpled leaf (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G109800 339 / 2e-118 AT5G51020 438 / 4e-157 constitutive activator of AAA-ATPase, crumpled leaf (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0116 Calycin PF06206 CpeT CpeT/CpcT family (DUF1001)
Representative CDS sequence
>Lus10032529 pacid=23146226 polypeptide=Lus10032529 locus=Lus10032529.g ID=Lus10032529.BGIv1.0 annot-version=v1.0
ATGGGAACGAGCTCTGGCTCAGATAAGGACGACTCCGATGGATGGGGCAAAACTCAGGGACTGGTGGTGAAGACGCTGATTTTGATCGGAGGTGCCTTTC
TGGTGAAGCGGTTTACTAAATCCACTACACGTTGGGACCATGCTAACCACGTTTCCCAATCGCTCTCCGGTGAAAAAGGAGCTTCCATGCCTTTGTATCT
TAGTTGCAGGAAGGAAGTTGGAGAGACGATTATGTGTCCTGCTGCTGAAATGGTTGATGGTACACAGGCATTTTGGCGCAATCCTCAGAAACCCTTTCGG
CAAAGGTTCTACATGGTGAAGCCTTGCCCAAAGGAGTTGAAATGTGATGTGGAGGTAAGCACTTATGCAATTAGGGATGCAGATGAGTACCTAAATTTCT
GTGATCGTCTGAGAGATCAACGACCACGTCCTGAAGAAGTAATTAGTGGCATTGCAGAACAGCTCAGTACATTACATCTAAAACGATGTGATCGTGGAAA
ACGCTGCATGTACAAAGGTTCGACGCCTCCTGGAGGATTCCCTAACACATGGAATGACGCCACTTATTGTACCTCGGAACTTTCCGTATTGAAGAACAAC
GAAGTGCATATGTGGGACAGGTGTTACGATGATGATGGAAACCAGGTTTGGGGATCAAGGGAAAGTCCATACGAGTTCAAGCCTGCACCAGGTTCTTCTG
GCAGTCTGAATGGGATTTTCTCTTCATTGAATCTCAGTCCACTAGCAAAAAGATGA
AA sequence
>Lus10032529 pacid=23146226 polypeptide=Lus10032529 locus=Lus10032529.g ID=Lus10032529.BGIv1.0 annot-version=v1.0
MGTSSGSDKDDSDGWGKTQGLVVKTLILIGGAFLVKRFTKSTTRWDHANHVSQSLSGEKGASMPLYLSCRKEVGETIMCPAAEMVDGTQAFWRNPQKPFR
QRFYMVKPCPKELKCDVEVSTYAIRDADEYLNFCDRLRDQRPRPEEVISGIAEQLSTLHLKRCDRGKRCMYKGSTPPGGFPNTWNDATYCTSELSVLKNN
EVHMWDRCYDDDGNQVWGSRESPYEFKPAPGSSGSLNGIFSSLNLSPLAKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G51020 CAA33, CRL constitutive activator of AAA-... Lus10032529 0 1
AT2G32230 PRORP1 proteinaceous RNase P 1 (.1) Lus10014928 1.4 0.9433
AT4G24740 AME1, AFC2 FUS3-complementing gene 2 (.1.... Lus10043309 2.2 0.9470
AT1G28560 SRD2 SHOOT REDIFFERENTIATION DEFECT... Lus10041957 2.8 0.9404
AT5G11270 OCP3 overexpressor of cationic pero... Lus10002899 3.0 0.9272
AT1G16670 Protein kinase superfamily pro... Lus10042851 4.9 0.9415
AT1G15200 protein-protein interaction re... Lus10003959 6.6 0.9211
AT1G05620 NSH2, URH2 nucleoside hydrolase 2, uridin... Lus10022062 8.9 0.9338
AT1G04390 BTB/POZ domain-containing prot... Lus10002546 9.2 0.9087
AT3G47160 RING/U-box superfamily protein... Lus10005859 9.5 0.9144
Lus10006006 13.4 0.9225

Lus10032529 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.