Lus10032535 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033028 165 / 4e-51 ND /
Lus10025539 160 / 1e-50 ND 35 / 0.009
Lus10021744 135 / 7e-41 ND /
Lus10010609 135 / 2e-39 ND /
Lus10012674 83 / 8e-21 ND /
Lus10039431 82 / 1e-19 ND /
Lus10003221 72 / 3e-16 ND /
Lus10030123 67 / 8e-14 ND /
Lus10012492 66 / 2e-13 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0274 WRKY-GCM1 PF03108 DBD_Tnp_Mut MuDR family transposase
Representative CDS sequence
>Lus10032535 pacid=23146384 polypeptide=Lus10032535 locus=Lus10032535.g ID=Lus10032535.BGIv1.0 annot-version=v1.0
ATGACAAACTCAGCCACTTACAACGCGCGGTGCATCCTACGAAGCGCGGCGCATTGTAGGTGGCCTATAACGGCACCCGAGCTGTACACAACGTTGGGCG
ATAACATCAACAAGATGATGACTGCTGACCACTATGAGGGTTGCCCTGAGATCCCGGATTTTGACCCCACCCGTCAACATTTCTACATCGACCGACGGTT
TTACACGAAGAAGGAGGCAAGTTTTGCCGTAAAACACTGGGCATTGCATAACAATCGAGCCCTGGCGACGTCTCACTCAAAGACTTGGGAGTTGGAGGTC
ATGTGTTATTCTCACAAAACTAACAACTGTCCATGGAGGTTACGCGTCACCGGCAGCGCAGGTGATGGGTTCTGGGCGGGTCAGCAGTGGAATCCACAAC
ACACATGTGACGGAAGCGAGCACAAAGTAGAATCTATCGAACTAGATGTGAATGTCATCGTGGATGCGGTGATGCACCTTGTCCGGTCAAGGCCACACTT
TCTGATCCGTTTGATCCAAGATGAGATTCCACACCTTTTCCAACGTCAGATCTCGTAG
AA sequence
>Lus10032535 pacid=23146384 polypeptide=Lus10032535 locus=Lus10032535.g ID=Lus10032535.BGIv1.0 annot-version=v1.0
MTNSATYNARCILRSAAHCRWPITAPELYTTLGDNINKMMTADHYEGCPEIPDFDPTRQHFYIDRRFYTKKEASFAVKHWALHNNRALATSHSKTWELEV
MCYSHKTNNCPWRLRVTGSAGDGFWAGQQWNPQHTCDGSEHKVESIELDVNVIVDAVMHLVRSRPHFLIRLIQDEIPHLFQRQIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032535 0 1
AT2G27930 PLATZ transcription factor fam... Lus10036044 4.1 0.8736
Lus10000400 6.5 0.8728
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Lus10026877 7.9 0.8728
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029390 9.2 0.8728
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10029913 10.2 0.8728
AT1G31280 AGO2 argonaute 2, Argonaute family ... Lus10018290 10.6 0.7240
AT5G18460 Protein of Unknown Function (D... Lus10006860 11.2 0.8728
Lus10009372 12.1 0.8728
AT4G29280 LCR22 low-molecular-weight cysteine-... Lus10015983 13.0 0.8728
AT3G45600 TET3 tetraspanin3 (.1) Lus10023218 14.7 0.8654

Lus10032535 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.