Lus10032560 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55160 174 / 2e-58 ATSUMO2, SUMO2, SUM2 small ubiquitin-like modifier 2 (.1.2)
AT4G26840 169 / 2e-56 ATSUMO1, SUMO1, SUM1 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1)
AT5G55170 98 / 5e-28 ATSUMO3, SUMO3, SUM3 small ubiquitin-like modifier 3 (.1)
AT5G55856 92 / 9e-26 Ubiquitin-like superfamily protein (.1)
AT5G48710 83 / 7e-22 Ubiquitin-like superfamily protein (.1)
AT2G32765 78 / 5e-20 ATSUMO5, SUM5 SUMO 5, small ubiquitinrelated modifier 5 (.1)
AT5G48700 69 / 1e-16 Ubiquitin-like superfamily protein (.1)
AT5G55855 47 / 2e-08 Ubiquitin-like superfamily protein (.1)
AT1G68185 47 / 1e-07 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043185 205 / 1e-70 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2)
Lus10032561 203 / 8e-70 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2)
Lus10043184 134 / 1e-42 AT5G55160 108 / 2e-32 small ubiquitin-like modifier 2 (.1.2)
Lus10022539 61 / 7e-14 AT5G55160 61 / 5e-14 small ubiquitin-like modifier 2 (.1.2)
Lus10026174 62 / 1e-12 AT1G53520 259 / 3e-84 Chalcone-flavanone isomerase family protein (.1)
Lus10000234 49 / 4e-08 AT1G68185 154 / 1e-46 Ubiquitin-like superfamily protein (.1)
Lus10034627 49 / 4e-08 AT1G68185 154 / 1e-46 Ubiquitin-like superfamily protein (.1)
Lus10035259 49 / 5e-08 AT1G68185 156 / 3e-47 Ubiquitin-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G158300 174 / 3e-58 AT5G55160 171 / 5e-57 small ubiquitin-like modifier 2 (.1.2)
Potri.002G224800 172 / 1e-57 AT5G55160 172 / 3e-57 small ubiquitin-like modifier 2 (.1.2)
Potri.002G224700 171 / 6e-57 AT4G26840 170 / 1e-56 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1)
Potri.014G190300 166 / 4e-55 AT5G55160 168 / 7e-56 small ubiquitin-like modifier 2 (.1.2)
Potri.010G118900 48 / 7e-08 AT1G68185 164 / 7e-51 Ubiquitin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence
>Lus10032560 pacid=23146229 polypeptide=Lus10032560 locus=Lus10032560.g ID=Lus10032560.BGIv1.0 annot-version=v1.0
ATGTCAGGAGTAACCAACCAGGAAGAGGAGAAGAAGCCGGCAGATCAAGGAGCTCACATCAACCTCAAGGTCAAGGGCCAGGATGGGAATGAAGTCTTCT
TCAGGATAAAGAGAAGCACCCAATTGAAGAAGCTGATGGGTGCATATTGTGACCGTCAGTCTGTTGACCTCAACGCCATTGCATTCTTGTTTGATGGCCG
CAGACTCCGTGCTGAGCAGACTCCAGATGAGCTAGAGATGGAGGATGGAGATGAAATAGATGCGATGCTCCATCAGACGGGTGGTGGTGCGAGTGTCTAG
AA sequence
>Lus10032560 pacid=23146229 polypeptide=Lus10032560 locus=Lus10032560.g ID=Lus10032560.BGIv1.0 annot-version=v1.0
MSGVTNQEEEKKPADQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMGAYCDRQSVDLNAIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGGASV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55160 ATSUMO2, SUMO2,... small ubiquitin-like modifier ... Lus10032560 0 1
AT1G30475 unknown protein Lus10027131 1.4 0.8630
AT5G04280 AtRZ-1c AtRZ-1c, RNA-binding (RRM/RBD/... Lus10037950 1.7 0.8754
AT5G04280 AtRZ-1c AtRZ-1c, RNA-binding (RRM/RBD/... Lus10038683 2.4 0.8462
AT5G24165 unknown protein Lus10014921 3.5 0.8092
AT3G06610 DNA-binding enhancer protein-r... Lus10016913 4.5 0.7965
AT1G20580 Small nuclear ribonucleoprotei... Lus10030747 6.3 0.8067
AT2G45250 Integral membrane protein hemo... Lus10014432 6.9 0.7403
AT3G02220 unknown protein Lus10019392 7.4 0.8222
AT3G07930 DNA glycosylase superfamily pr... Lus10001994 8.1 0.7890
AT5G52200 AtI-2 inhibitor-2, phosphoprotein ph... Lus10027444 9.0 0.7987

Lus10032560 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.