Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55160 174 / 2e-58 ATSUMO2, SUMO2, SUM2 small ubiquitin-like modifier 2 (.1.2) AT4G26840 169 / 2e-56 ATSUMO1, SUMO1, SUM1 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1) AT5G55170 99 / 4e-28 ATSUMO3, SUMO3, SUM3 small ubiquitin-like modifier 3 (.1) AT5G55856 92 / 9e-26 Ubiquitin-like superfamily protein (.1) AT5G48710 83 / 7e-22 Ubiquitin-like superfamily protein (.1) AT2G32765 78 / 5e-20 ATSUMO5, SUM5 SUMO 5, small ubiquitinrelated modifier 5 (.1) AT5G48700 69 / 1e-16 Ubiquitin-like superfamily protein (.1) AT5G55855 47 / 2e-08 Ubiquitin-like superfamily protein (.1) AT1G68185 47 / 1e-07 Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043185 [exp] 203 / 8e-70 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2) Lus10032560 [exp] 203 / 8e-70 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2) Lus10043184 [exp] 135 / 4e-43 AT5G55160 108 / 2e-32 small ubiquitin-like modifier 2 (.1.2) Lus10022539 [exp] 61 / 7e-14 AT5G55160 61 / 5e-14 small ubiquitin-like modifier 2 (.1.2) Lus10026174 [exp] 62 / 2e-12 AT1G53520 259 / 3e-84 Chalcone-flavanone isomerase family protein (.1) Lus10000234 [exp] 49 / 4e-08 AT1G68185 154 / 1e-46 Ubiquitin-like superfamily protein (.1) Lus10034627 [exp] 49 / 4e-08 AT1G68185 154 / 1e-46 Ubiquitin-like superfamily protein (.1) Lus10035259 [exp] 49 / 6e-08 AT1G68185 156 / 3e-47 Ubiquitin-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G158300 [exp] 172 / 1e-57 AT5G55160 171 / 5e-57 small ubiquitin-like modifier 2 (.1.2) Potri.002G224800 [exp] 171 / 6e-57 AT5G55160 172 / 3e-57 small ubiquitin-like modifier 2 (.1.2) Potri.002G224700 [exp] 171 / 7e-57 AT4G26840 170 / 1e-56 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1) Potri.014G190300 [exp] 166 / 3e-55 AT5G55160 168 / 7e-56 small ubiquitin-like modifier 2 (.1.2) Potri.010G118900 [exp] 48 / 8e-08 AT1G68185 164 / 7e-51 Ubiquitin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF11976 [flax] [poplar] Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence Show only first row Show all	>Lus10032561 pacid=23146368 polypeptide=Lus10032561 locus=Lus10032561.g ID=Lus10032561.BGIv1.0 annot-version=v1.0 ATGTCAGGAGTAGTCAACCAGGAGGAAGAGAAGAAGCCGGCAGATCAGGGAGCTCACATCAACCTCAAGGTCAAGGGCCAGGATGGGAATGAAGTCTTCT TCAGGATCAAGAGGAGCACCCAATTGAAGAAGCTGATGGGTGCATATTGTGACCGTCAGTCTGTTGACCTCAACGCCATTGCATTCTTGTTTGATGGCCG CAGACTCCGCGCCGAGCAGACTCCAGATGAGCTAGAGATGGAGGATGGAGATGAAATAGATGCGATGCTCCATCAGACGGGGGGTGGCGCGAGTGTCTAG
AA sequence Show only first row Show all	>Lus10032561 pacid=23146368 polypeptide=Lus10032561 locus=Lus10032561.g ID=Lus10032561.BGIv1.0 annot-version=v1.0 MSGVVNQEEEKKPADQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMGAYCDRQSVDLNAIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGGASV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10032561 [exp]	0	1
AT3G59380		FTA, PLP, ATFTA...	PLURIPETALA, farnesyltransfera...		Lus10015954 [exp]	1.4	0.8497
AT5G54680	bHLH	bHLH105, ILR3	iaa-leucine resistant3, basic ...		Lus10043076 [exp]	2.4	0.8350
AT2G02510			NADH dehydrogenase (ubiquinone...		Lus10005182 [exp]	2.6	0.8135
AT5G42000			ORMDL family protein (.1.2)		Lus10023031 [exp]	3.2	0.8247
AT3G02120			hydroxyproline-rich glycoprote...		Lus10015381 [exp]	3.9	0.8280
AT5G62200			Embryo-specific protein 3, (AT...		Lus10031684 [exp]	4.5	0.8273
AT4G34630			unknown protein		Lus10028793 [exp]	4.9	0.8165
AT5G17510			unknown protein		Lus10024979 [exp]	5.3	0.7883
AT4G11560			bromo-adjacent homology (BAH) ...		Lus10008527 [exp]	6.2	0.7887
AT5G19910		MED31	SOH1 family protein (.1.2)		Lus10021434 [exp]	6.8	0.7590

Compare expression of checked genes

Lus10032561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.